Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MQVPQDGEDLAGQPWYHGLLSRQKAEALLQQNGDFLVRASGSRGGNPVIS CRWRGSALHFEVFRVALRPRPGRPTALFQLEDEQFPSIPALVHSYMTGRR PLSQATGAVVSRPVTWQGPLRRSFSEDTLMDGPARIEPLRARKWSNSQPA DLAHMGRSREDPAGMEASTMPISALPRTSSDPVLLKAPAPLGTVADSLRA SDGQLQAKAPTKPPRTPSFELPDASERPPTYCELVPRVPSVQGTSPSQSC PEPEAPWWEAEEDEEEENRCFTRPQAEISFCPHDAPSCLLGPQNRPLEPQ VLHTLRGLFLEHHPGSTALHLLLVDCQATGLLGVTRDQRGNMGVSSGLEL LTLPHGHHLRLELLERHQTLALAGALAVLGCSGPLEERAAALRGLVELAL ALRPGAAGDLPGLAAVMGALLMPQVSRLEHTWRQLRRSHTEAALAFEQEL KPLMRALDEGAGPCDPGEVALPHVAPMVRLLEGEEVAGPLDESCERLLRT LHGARHMVRDAPKFRKVAAQRLRGFRPNPELREALTTGFVRRLLWGSRGA GAPRAERFEKFQRVLGVLSQRLEPDR
    • Amino acids
      1 to 576
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160779 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Novel SH2 containing protein 1
    • Novel SH2-containing protein 1
    • NSP1
    • SH2 domain containing 3A
    • SH2 domain containing protein 3A
    • SH2 domain-containing protein 3A
    • SH23A_HUMAN
    • SH2D3A
    see all
  • Function
    May play a role in JNK activation.
  • Tissue specificity
    Weakly expressed in placenta, fetal kidney, fetal lung, adult pancreas, adult kidney and adult lung.
  • Sequence similarities
    Contains 1 SH2 domain.
  • Post-translational
    modifications
    Phosphorylated on tyrosine.
  • Information by UniProt

Images

  • ab160779 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160779 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160779.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up