Overview

  • Product name
    Recombinant Human SH2D4A protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KKANELLLSTGMPGSFLIRVSERIKGYALSYLSEDGCKHFLIDASADAYS FLGVDQLQHATLADLVEYHKEEPITSLGKELLLYPCGQQDQLPDYLELFE
    • Amino acids
      239 to 338
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163751 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ20967
    • PPP1R38
    • Protein phosphatase 1 regulatory subunit 38
    • Protein SH
    • Protein SH(2)A
    • Protein SH2A
    • SH2 domain containing 4A
    • SH2 domain containing protein 4A
    • SH2 domain-containing protein 4A
    • SH24A_HUMAN
    • SH2A
    • Sh2d4a
    see all
  • Function
    Inhibits estrogen-induced cell proliferation by competing with PLCG for binding to ESR1, blocking the effect of estrogen on PLCG and repressing estrogen-induced proliferation. May play a role in T-cell development and function.
  • Tissue specificity
    Ubiquitously expressed. Aberrantly expressed in some cancers.
  • Sequence similarities
    Contains 1 SH2 domain.
  • Cellular localization
    Cytoplasm. Located at podocyte foot processes.
  • Information by UniProt

Images

  • ab163751 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163751 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163751.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up