Description

  • Product name

    Recombinant Human SH3BGRL3 protein
  • Purity

    > 95 % SDS-PAGE.
    ab134546 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMSGLRVYSTSVTGSREIKSQQSEVTRI LDGKRIQYQLVDISQDNALRDEMRALAGNPKATPPQIVNGDQYCGDYELF VEAVEQNTLQEFLKLA
    • Predicted molecular weight

      13 kDa including tags
    • Amino acids

      1 to 93
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab134546 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names

    • epididymis secretory protein Li 297
    • HEL-S-297
    • SH3 domain binding glutamic acid rich protein like 3
    • SH3 domain-binding glutamic acid-rich-like protein 3
    • SH3 domain-binding protein 1
    • Sh3bgrl3
    • SH3BGRL3 like protein
    • SH3BP-1
    • SH3L3_HUMAN
    • TIP B1
    • TIP-B1
    • TNF inhibitory protein
    see all
  • Function

    Could act as a modulator of glutaredoxin biological activity.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the SH3BGR family.
    Contains 1 glutaredoxin domain.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab134546.

References

ab134546 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab134546.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up