Description

  • Product name

    Recombinant Human SH3BP2 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      PLPNSVFVNTTESCEVERLFKATSPRGEPQDGLYCIRNSSTKSGKVLVVW DETSNKVRNYRIFEKDSKFYLEGEVLFVSVGSMVEHYHTHVLPSHQSLLL RHPYGYTGPR
    • Amino acids

      452 to 561
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159503 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 3BP-2
    • 3BP2
    • 3BP2_HUMAN
    • Abl SH3 binding protein 2
    • Cherubism
    • CRBM
    • CRPM
    • FLJ42079
    • FLJ54978
    • RES4-23
    • SH3 domain binding protein 2
    • SH3 domain-binding protein 2
    • Sh3bp2
    • TNFAIP3 interacting protein 2
    see all
  • Function

    Binds differentially to the SH3 domains of certain proteins of signal transduction pathways. Binds to phosphatidylinositols; linking the hemopoietic tyrosine kinase fes to the cytoplasmic membrane in a phosphorylation dependent mechanism.
  • Tissue specificity

    Expressed in a variety of tissues including lung, liver, skeletal muscle, kidney and pancreas.
  • Involvement in disease

    Defects in SH3BP2 are the cause of cherubism (CRBM) [MIM:118400]. CRBM is an autosomal dominant inherited syndrome characterized by excessive bone degradation of the upper and lower jaws, which often begins around three years of age. It is followed by development of fibrous tissue masses, which causes a characteristic facial swelling.
  • Sequence similarities

    Contains 1 PH domain.
    Contains 1 SH2 domain.
  • Information by UniProt

Images

  • ab159503 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159503 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159503.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up