Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GLEEEEEVDPRIQGELEKLNQSTDDINRRETELEDARQKFRSVLVEATVK LDELVKKIGKAVEDSKPYWEARRVARQAQLEAQKATQDFQRATEVLRAAK ETISLAEQR
    • Amino acids
      4 to 112
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160499 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3BP5_HUMAN
    • OTTHUMP00000208289
    • OTTHUMP00000208291
    • OTTHUMP00000208294
    • SAB
    • SH3 binding protein
    • SH3 domain binding protein 5
    • SH3 domain binding protein 5 (BTK associated)
    • SH3 domain binding protein that preferentially associates with BTK
    • SH3 domain-binding protein 5
    • SH3 domain-binding protein that preferentially associates with BTK
    • SH3 domainbinding protein 5
    • SH3BP 5
    • SH3BP-5
    • Sh3bp5
    see all
  • Function
    Inhibits the auto- and transphosphorylation activity of BTK. Plays a negative regulatory role in BTK-related cytoplasmic signaling in B-cells. May be involved in BCR-induced apoptotic cell death.
  • Tissue specificity
    Highly expressed in testis and ovaries. It is also expressed in a variety of tissues including spleen, lymph node, thymus, bone marrow, fetal liver, colon, small intestine and prostate.
  • Sequence similarities
    Belongs to the SH3BP5 family.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Images

  • ab160499 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160499 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160499.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up