Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDLQKKQSNLATGLSKAKSQVFKNQDPVLPPRPKPGHPLYSKYMLSVPHG IANEDIVSQNPGELSCKRGDVLVMLKQTENNYLECQKGEDTGRVHLSQMK IITPLDEHLRSRPNDPSHAQKPVDSGAPHAVVLHDFPAEQVDDLNLTSGE IVYLLEKIDTDWYRGNCRNQIGIFPANYVKVIIDIPEGGNGKRECVSSHC VKGSRCVARFEYIGEQKDELSFSEGEIIILKEYVNEEWARGEVRGRTGIF PLNFVEPVEDYPTSGANVLSTKVPLKTKKEDSGSNSQVNSLPAEWCEALH SFTAETSDDLSFKRGDRIQILERLDSDWCRGRLQDREGIFPAVFVRPCPA EAKSMLAIVPKGRKAKALYDFRGENEDELSFKAGDIITELESVDDDWMSG ELMGKSGIFPKNYIQFLQIS
    • Amino acids
      1 to 420
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165648 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ADAM-binding protein Eve-1
    • EBP
    • EEN-binding protein
    • SH3 domain protein D19
    • SH3 domain-containing protein 19
    • SH319_HUMAN
    • Sh3d19
    • SH3D19 protein
    see all
  • Function
    May play a role in regulating A disintegrin and metalloproteases (ADAMs) in the signaling of EGFR-ligand shedding. May be involved in suppression of Ras-induced cellular transformation and Ras-mediated activation of ELK1.
  • Tissue specificity
    Widely expressed with highest levels in heart, skeletal muscle, kidney, liver, placenta, small intestine and lung. Expressed at low levels in colon, thymus, spleen and leukocytes.
  • Sequence similarities
    Contains 5 SH3 domains.
  • Cellular localization
    Cytoplasm. Nucleus. Is recruited to the nucleus by the MLL-EEN fusion protein;.
  • Information by UniProt

Images

  • ab165648 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165648 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165648.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up