Description

  • Product name

    Recombinant Human SH3GL3 protein (His tag)
  • Purity

    > 90 % SDS-PAGE.
    ab202261 was purified using conventional chromatography.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMSVAGLKKQFHKASQLFSEKISGAEGT KLDDEFLDMERKIDVTNKVVAEILSKTTEYLQPNPAYRAKLGMLNTVSKI RGQVKTTGYPQTEGLLGDCMLKYGKELGEDSTFGNALIEVGESMKLMAEV KDSLDINVKQTFIDPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKKKRVGK IPDEEVRQAVEKFEESKELAERSMFNFLENDVEQVSQLAV FIEAALDYHRQSTEILQELQSKLQMRISAASSVPRREYKPRPVKRSSSEL NGVSTTSVVKTTGSNIPMDQPCCRGLYDFEPENQGELGFKEGDIITLTNQ IDENWYEGMIHGESGFFPINYVEVIVPLPQ
    • Predicted molecular weight

      42 kDa including tags
    • Amino acids

      1 to 347
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NCBI Accession No.: NP_003018

Specifications

Our Abpromise guarantee covers the use of ab202261 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 10% Glycerol, 0.02% DTT, 89% PBS

General Info

  • Alternative names

    • CNSA3
    • EEN 2B L3
    • EEN B2
    • EEN-B2
    • EEN2BL3
    • EENB2
    • Endophilin 3
    • Endophilin A3
    • Endophilin-3
    • Endophilin-A3
    • H.sapiens mRNA for protein containing SH3 domain, SH3GL3
    • HsT19371
    • SH3 domain containing GRB2 like protein 3
    • SH3 domain GRB2 like 3
    • SH3 domain protein 2C
    • SH3 domain-containing GRB2-like protein 3
    • SH3D2C
    • SH3G3_HUMAN
    • SH3GL3
    • SH3P13
    see all
  • Function

    Implicated in endocytosis. May recruit other proteins to membranes with high curvature.
  • Tissue specificity

    Brain and testis.
  • Sequence similarities

    Belongs to the endophilin family.
    Contains 1 BAR domain.
    Contains 1 SH3 domain.
  • Domain

    An N-terminal amphipathic helix, the BAR domain and a second amphipathic helix inserted into helix 1 of the BAR domain (N-BAR domain) induce membrane curvature and bind curved membranes.
  • Cellular localization

    Cytoplasm. Early endosome membrane. Associated with postsynaptic endosomes in hippocampal neurons. Associated with presynaptic endosomes in olfactory neurons.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab202261 (3 µg)

References

ab202261 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202261.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up