Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      IKLRPRSIEVENDFLPVEKTIGKKLPATTATPDSSKTEMDSRTKSKDYCK VIFPYEAQNDDELTIKEGDIVTLINKDCIDVGWWE
    • Amino acids
      224 to 308
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162312 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • c Cbl interacting protein
    • Cbl interacting protein
    • Cbl interacting protein of 85 kDa
    • Cbl-interacting protein of 85 kDa
    • CD2 binding protein 3
    • CD2-binding protein 3
    • CD2BP3
    • CIN 85
    • CIN85
    • GIG 10
    • GIG10
    • HSB 1
    • HSB-1
    • HSB1
    • Human Src family kinase binding protein 1
    • Human Src family kinase-binding protein 1
    • MIG 18
    • MIG18
    • Migration inducing gene 18
    • Migration inducing gene 18 protein
    • SH3 domain kinase binding protein 1
    • SH3 domain-containing kinase-binding protein 1
    • SH3BP 1
    • SH3K1_HUMAN
    • SH3KBP1
    • Src family kinase binding protein 1
    • src related kinase binding protein 1
    see all
  • Function
    Adapter protein involved in regulating diverse signal transduction pathways. Involved in the regulation of endocytosis and lysosomal degradation of ligand-induced receptor tyrosine kinases, including EGFR and MET/hepatocyte growth factor receptor, through a association with CBL and endophilins. The association with CBL, and thus the receptor internalization, may inhibited by an interaction with PDCD6IP and/or SPRY2. Involved in regulation of ligand-dependent endocytosis of the IgE receptor. Attenuates phosphatidylinositol 3-kinase activity by interaction with its regulatory subunit (By similarity). May be involved in regulation of cell adhesion; promotes the interaction between TTK2B and PDCD6IP. May be involved in the regulation of cellular stress response via the MAPK pathways through its interaction with MAP3K4. Is involved in modulation of tumor necrosis factor mediated apoptosis.
  • Tissue specificity
    Ubiquitously expressed. Also expressed in some cancer cell lines.
  • Sequence similarities
    Contains 3 SH3 domains.
  • Domain
    The SH3 domains mediate interaction with SHKBP1.
  • Post-translational
    modifications
    Monoubiquitinated by CBL and CBLB after EGF stimulation; probably on its C-terminus.
  • Cellular localization
    Cytoplasm > cytoskeleton. Cytoplasmic vesicle membrane. Cell junction > synapse > synaptosome. Cell junction > focal adhesion. Localized in endocytic vesicles containing clustered receptors. Colocalizes with ASAP1 in vesicular structures. Colocalized with actin microfilaments and focal adhesions (By similarity). Colocalized with MAGI2 in synaptosomes.
  • Information by UniProt

Images

  • ab162312 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162312 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162312.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up