Recombinant Human SH3KBP1 protein (ab162312)
- Datasheet
- References
- Protocols
Overview
-
Product nameRecombinant Human SH3KBP1 protein
See all SH3KBP1 proteins and peptides -
Protein lengthProtein fragment
Description
-
NatureRecombinant
-
SourceWheat germ
-
Amino Acid Sequence
-
SpeciesHuman
-
SequenceIKLRPRSIEVENDFLPVEKTIGKKLPATTATPDSSKTEMDSRTKSKDYCK VIFPYEAQNDDELTIKEGDIVTLINKDCIDVGWWE
-
Amino acids224 to 308
-
Tagsproprietary tag N-Terminus
-
Specifications
Our Abpromise guarantee covers the use of ab162312 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
ELISA
Western blot
-
FormLiquid
-
Additional notesProtein concentration is above or equal to 0.05 mg/ml.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- c Cbl interacting protein
- Cbl interacting protein
- Cbl interacting protein of 85 kDa
see all -
FunctionAdapter protein involved in regulating diverse signal transduction pathways. Involved in the regulation of endocytosis and lysosomal degradation of ligand-induced receptor tyrosine kinases, including EGFR and MET/hepatocyte growth factor receptor, through a association with CBL and endophilins. The association with CBL, and thus the receptor internalization, may inhibited by an interaction with PDCD6IP and/or SPRY2. Involved in regulation of ligand-dependent endocytosis of the IgE receptor. Attenuates phosphatidylinositol 3-kinase activity by interaction with its regulatory subunit (By similarity). May be involved in regulation of cell adhesion; promotes the interaction between TTK2B and PDCD6IP. May be involved in the regulation of cellular stress response via the MAPK pathways through its interaction with MAP3K4. Is involved in modulation of tumor necrosis factor mediated apoptosis.
-
Tissue specificityUbiquitously expressed. Also expressed in some cancer cell lines.
-
Sequence similaritiesContains 3 SH3 domains.
-
DomainThe SH3 domains mediate interaction with SHKBP1.
-
Post-translational
modificationsMonoubiquitinated by CBL and CBLB after EGF stimulation; probably on its C-terminus. -
Cellular localizationCytoplasm > cytoskeleton. Cytoplasmic vesicle membrane. Cell junction > synapse > synaptosome. Cell junction > focal adhesion. Localized in endocytic vesicles containing clustered receptors. Colocalizes with ASAP1 in vesicular structures. Colocalized with actin microfilaments and focal adhesions (By similarity). Colocalized with MAGI2 in synaptosomes.
- Information by UniProt
Images
Datasheets and documents
References
ab162312 has not yet been referenced specifically in any publications.