Overview

  • Product name
    Recombinant Human SH3YL1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNNPIPSNLKSEAKKAAKILREFTEITSRNGPDKIIPAHVIAKAKGLAIL SVIKAGFLVTARGGSGIVVARLPDGKWSAPSAIGIAGLGGGFEIGIEVSD LVIILNYDRAVEAFAKGGNLTLGGNLTVAVGPLGRNLEGNVALRSSAAVF TYCKSRGLFAGVSLEGSCLIERKETNRKFYCQDIRAYDILFGDTPRPAQA EDLYEILDSFTEKYENEGQRINARKAAREQRKSSAKELPPKPLSRPQQSS APVQLNSGSQSNLNQPIEVTALYSFEGQQPGDLNFQAGDRITVISKTDSH FDWWEGKLRGQTGIFPANYVTMN
    • Amino acids
      1 to 323
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162039 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZP586F1318
    • RAY
    • SH3 domain containing, Ysc84-like 1 (S. cerevisiae)
    • SH3 domain-containing YSC84-like protein 1
    • SH3Y1_HUMAN
    • Sh3yl1
    see all
  • Sequence similarities
    Belongs to the SH3YL1 family.
    Contains 1 SH3 domain.
  • Information by UniProt

Images

  • ab162039 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162039 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162039.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up