Overview

  • Product name

    Recombinant Human SHANK2 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      SILQQMNREKLAKPGEGLDSPMGAKSASLAPRSPEIMSTISGTRSTTVTF TVRPGTSQPITLQSRPPDYESRTSGTRRAPSPVVSPTEMNK
    • Amino acids

      1034 to 1124
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153196 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AUTS17
    • Cortactin binding protein 1
    • Cortactin SH3 domain-binding protein
    • Cortactin-binding protein 1
    • CortBP1
    • CTTNBP1
    • GKAP/SAPAP interacting protein
    • GKAP/SAPAP-interacting protein
    • KIAA1022
    • Proline rich synapse associated protein 1
    • Proline-rich synapse-associated protein 1
    • ProSAP1
    • SH3 and multiple ankyrin repeat domains 2
    • SH3 and multiple ankyrin repeat domains protein 2
    • SHAN2_RAT
    • SHANK
    • Shank2
    • SPANK-3
    see all
  • Function

    Seems to be an adapter protein in the postsynaptic density (PSD) of excitatory synapses that interconnects receptors of the postsynaptic membrane including NMDA-type and metabotropic glutamate receptors, and the actin-based cytoskeleton. May play a role in the structural and functional organization of the dendritic spine and synaptic junction.
  • Tissue specificity

    Expressed in epithelial cells (at protein level). All isoforms except isoform 7 are expressed predominantly in brain, with highest levels in olfactory bulb, cerebral cortex, cerebellum, central gray matter and hippocampus. Moderate levels of expression are seen in the caudate putamen, thalamic nuclei and brain stem. In cerebellum primarily expressed in Purkinje cells. Isoform 7 is not expressed in brain but expressed in liver, cholangiocytes and thymus. Isoform 7 is present in pancreas, colonic mucosa and thymocytes (at protein level).
  • Sequence similarities

    Belongs to the SHANK family.
    Contains 1 PDZ (DHR) domain.
    Contains 1 SAM (sterile alpha motif) domain.
    Contains 1 SH3 domain.
  • Developmental stage

    Expressed during early postnatal brain development, especially in the caudate putamen and thalamic nuclei. Expression in the cerebral cortex, the hippocampus and the cerebellum is moderate to high at P5 and shows a stable expression throughout development. Isoforms 1, 2, 4 and 6 are predominantly expressed in cerebellum up to the age of approximately 3 weeks. Isoform 1 expression decreases during development of cortex but slightly increases in cerebellum.
  • Domain

    The PDZ domain is required for interaction with GRID2, PLCB3, SLC9A3 and CFTR.
  • Cellular localization

    Apical cell membrane. Cytoplasm. Cell junction, synapse. Cell junction, synapse, postsynaptic cell membrane, postsynaptic density. Cell projection, growth cone. Cell projection, dendritic spine. Colocalizes with cortactin in growth cones in differentiating hippocampal neurons. Present in the dendritic spines of cerebellar Purkinje cells (By similarity). Colocalizes with cortactin in growth cones in differentiating hippocampal neurons. Colocalized with PDE4D to the apical membrane of colonic crypt cells.
  • Information by UniProt

Images

  • ab153196 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153196 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153196.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up