Overview

  • Product name

    Recombinant Human SHARP2/DEC1 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      LSGRNVETGQEMFCSGFQTCAREVLQYLAKHENTRDLKSSQLVTHLHRVV SELLQGGTSRKPSDPAPKVMDFKEKPSSPAKGSEGPGKNCVPVIQRTFAH
    • Molecular weight

      37 kDa including tags
    • Amino acids

      130 to 229

Specifications

Our Abpromise guarantee covers the use of ab152887 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.

     This product was previously labelled as SHARP2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • BHE40_HUMAN
    • bHLHB2
    • bHLHe40
    • Class B Basic Helix Loop Helix Protein 2
    • Class B basic helix-loop-helix protein 2
    • Class E basic helix loop helix protein 40
    • Class E basic helix-loop-helix protein 40
    • Clast5
    • DEC1
    • Differentially expressed in chondrocytes protein 1
    • E47 interaction protein 1
    • EIP1
    • Enhancer of split and hairy related protein 2
    • Enhancer-of-split and hairy-related protein 2
    • SHARP 2
    • SHARP-2
    • Stimulated by retinoic acid gene 13 protein
    • STRA13
    see all
  • Function

    Transcriptional repressor involved in the regulation of the circadian rhythm by negatively regulating the activity of the clock genes and clock-controlled genes. Acts as the negative limb of a novel autoregulatory feedback loop (DEC loop) which differs from the one formed by the PER and CRY transcriptional repressors (PER/CRY loop). Both these loops are interlocked as it represses the expression of PER1/2 and in turn is repressed by PER1/2 and CRY1/2. Represses the activity of the circadian transcriptional activator: CLOCK-ARNTL/BMAL1
    ARNTL2/BMAL2 heterodimer by competing for the binding to E-box elements (5'-CACGTG-3') found within the promoters of its target genes. Negatively regulates its own expression and the expression of DBP and BHLHE41/DEC2. Acts as a corepressor of RXR and the RXR-LXR heterodimers and represses the ligand-induced RXRA and NR1H3/LXRA transactivation activity. May be involved in the regulation of chondrocyte differentiation via the cAMP pathway.
  • Tissue specificity

    Expressed in cartilage, spleen, intestine, lung, and to a lesser extent in heart, brain, liver, muscle and stomach.
  • Sequence similarities

    Contains 1 bHLH (basic helix-loop-helix) domain.
    Contains 1 Orange domain.
  • Post-translational
    modifications

    Ubiquitinated; which may lead to proteasomal degradation.
    Sumoylation inhibits its ubiquitination and promotes its negative regulation of the CLOCK-ARNTL/BMAL1 heterodimer transcriptional activator activity.
  • Cellular localization

    Cytoplasm. Nucleus. Predominantly localized in the nucleus (PubMed:11278694).
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152887 stained with Coomassie Blue.

References

ab152887 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152887.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up