Overview

  • Product name
    Recombinant Human Shootin-1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPVLGSVSSVTKTALNKKTLEAEFNSPSPPTPEPGEGPRKLEGCTSSKVT FQPPSSIGCRKKYIDGEKQAEPVVVLDPVSTHEPQTKDQVAEKDPTQHKE DEGEIQPENKEDSIENVRETDSSNC
    • Amino acids
      1 to 125
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163626 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as KIAA1598 homolog. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp686A0439
    • hypothetical protein FLJ11122
    • Kiaa1598
    • KIAA1598 homolog
    • MGC40476
    • Putative uncharacterized protein KIAA1598
    • Shootin 1
    • Shootin-1
    • SHOT1_HUMAN
    see all
  • Function
    Involved in the generation of internal asymmetric signals required for neuronal polarization. Acts upstream of PI3K (phosphoinositide 3-kinase), by being required for spatially localized PI3K activity. Accumulates asymmetrically in a single neurite before polarization, leading to axon induction for polarization, its absence from the nascent axon's siblings by competition preventing the formation of surplus axons.
  • Sequence similarities
    Belongs to the shootin family.
  • Cellular localization
    Cell projection > axon.
  • Information by UniProt

Images

  • ab163626 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163626 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163626.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up