Overview

  • Product name

    Recombinant Human Shugoshin protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MAKERCLKKSFQDSLEDIKKRMKEKRNKNLAEIGKRRSFIAAPCQIITNT STLLKNYQDNNKMLVLALENEKSKVKEAQDIILQLRKECYYLTCQLYALK GKLTSQQTVEPAQNQEICSSGMDPNSDDSSRNLFVKDLPQIPLEETELPG QGESFQIEATPPETQQSPHLSLKDITNVSLYPVVKIRRLSLSPKKNKASP AVALPKRRCTASVNYKEPTLASKLRRGDPFTDLCFLNSPIFKQKKDLRRS KKRALEVSPAKEAIFILYYVREFVSRFPDCRKCKLETHICLR
    • Amino acids

      1 to 292
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153608 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • hSgo 1
    • hSgo1
    • NY BR 85
    • Serologically defined breast cancer antigen NY BR 85
    • Serologically defined breast cancer antigen NY-BR-85
    • SGO
    • SGO 1
    • SGO L1
    • SGO1
    • SGOL 1
    • SGOL1
    • SGOL1_HUMAN
    • Shugoshin 1AB protein
    • Shugoshin 1CD protein
    • Shugoshin 1EFprotein
    • Shugoshin 1GH protein
    • Shugoshin 1KL protein
    • Shugoshin like 1
    • Shugoshin like 1 (S. pombe)
    • Shugoshin-like 1
    see all
  • Function

    Plays a central role in chromosome cohesion during mitosis by preventing premature dissociation of cohesin complex from centromeres after prophase, when most of cohesin complex dissociates from chromosomes arms. May act by preventing phosphorylation of the STAG2 subunit of cohesin complex at the centromere, ensuring cohesin persistence at centromere until cohesin cleavage by ESPL1/separase at anaphase. Essential for proper chromosome segregation during mitosis and this function requires interaction with PPP2R1A. Its phosphorylated form is necessary for chromosome congression and for the proper attachment of spindle microtubule to the kinetochore. Necessary for kinetochore localization of PLK1 and CENPF. May play a role in the tension sensing mechanism of the spindle-assembly checkpoint by regulating PLK1 kinetochore affinity. Isoform 3 plays a role in maintaining centriole cohesion involved in controlling spindle pole integrity.
  • Tissue specificity

    Widely expressed. Highly expressed in testis. Expressed in lung, small intestine, breast, liver and placenta. Strongly overexpressed in 90% of breast cancers tested.
  • Sequence similarities

    Belongs to the shugoshin family.
  • Developmental stage

    Appears in prophase cells and remains present until metaphase. Strongly decreases at the onset of anaphase and completely disapears at telophase. Not present in interphase cells (at protein level).
  • Domain

    The KEN box and D-box 3 are required for its ubiquitination and degradation.
  • Post-translational
    modifications

    Ubiquitinated and degraded during mitotic exit by APC/C-Cdh1.
    Phosphorylation by NEK2 is essential for chromosome congression in mitosis and for the proper attachment of spindle microtubule to the kinetochore. Phosphorylated by PLK1 and AUKRB.
  • Cellular localization

    Nucleus. Chromosome > centromere. Chromosome > centromere > kinetochore. Cytoplasm > cytoskeleton > spindle pole. Cytoplasm > cytoskeleton > centrosome. Localizes to the inner centromere throughout prophase until metaphase and disappears at anaphase. During prometaphase, it localizes to a single focus, while at metaphase, it localizes to 2 spots corresponding to the 2 centromeres. Centromeric localization requires the presence of BUB1 and the interaction with PPP2R1A. Localizes to the inner kinetochore from prophase to early metaphase. Co-localizes with NEK2 and SS18L1 at the kinetochore. Phosphorylation by AUKRB and the presence of BUB1 are required for localization to the kinetochore. Isoform 1 primarily localizes to kinetochores during G2 phase and mitotic prophase, metaphase, and anaphase and does not appear to be associated with kinetochores during late mitosis. Isoform 3 is found at the centrosome in interphase and at spindle poles in mitosis and its spindle pole localization is PLK1 dependent. Isoform 3 does not localize to kinetochores during any stages of the cell cycle.
  • Information by UniProt

Images

  • ab153608 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153608 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153608.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up