Overview

  • Product name
    Recombinant Human SIA8D protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRSIRKKWTICTISLLLIFYKTKEIARTEEHQETQLIGDGELSLSRSLVN SSDKIIRKAGSSIFQHNVEGWKINSSLVLEIRKNILRFLDAERDVSVVKS SFKPGDVIHYVLDRRRTLNISHDLHSLLPEVSPMKNRRFKTCAVVGNSGI LLDSECGKEIDSHNFVIR
    • Amino acids
      1 to 168
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159906 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 8-sialyltransferase
    • 8-sialyltransferase 8D
    • Alpha 2 8 sialyltransferase 8D
    • Alpha-2
    • CMP N acetylneuraminate poly alpha 2 8 sialyl transferase
    • CMP-N-acetylneuraminate-poly-alpha-2
    • Polysialyltransferase 1
    • Polysialyltransferase-1
    • PST
    • PST1
    • SIA8D_HUMAN
    • Sialyltransferase 8 alpha 2 8 polysialytransferase D
    • Sialyltransferase 8D
    • Sialytransferase St8Sia IV
    • SIAT8-D
    • SIAT8D
    • ST8 alpha N acetyl neuraminide alpha 2 8 sialyltransferase 4
    • ST8Sia IV
    • ST8SIA4
    • ST8SiaIV
    see all
  • Function
    Catalyzes the polycondensation of alpha-2,8-linked sialic acid required for the synthesis of polysialic acid (PSA), which is present on the embryonic neural cell adhesion molecule (N-CAM), necessary for plasticity of neural cells.
  • Tissue specificity
    Highly expressed in fetal brain, lung and kidney and in adult heart, spleen and thymus. Present to a lesser extent in adult brain, placenta, lung, large and small intestine and peripheral blood leukocytes.
  • Pathway
    Protein modification; protein glycosylation.
  • Sequence similarities
    Belongs to the glycosyltransferase 29 family.
  • Cellular localization
    Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab159906 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159906 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159906.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up