Description

  • Product name

    Recombinant Human SIAE protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MVAPGLVLGLVLPLILWADRSAGIGFRFASYINNDMVLQKEPAGAVIWGF GTPGATVTVTLRQGQETIMKKVTSVKAHSDTWMVVLDPMKPGGPFEVMAQ QTLEKINFTLRVHDVLFGDVWLCSGQSNMQMTVLQIFNATRELSNTAAYQ SVRILSVSPIQAEQELEDLVAVDLQWSKPTSENLGHGYFKYMSAVCWLFG RHLYDTLQYPIGLIASSWGGTPIEAWSSGRSLKACGVPKQGSIPYDSVTG PSKHSVLWNAMIHPLCNMTLKGVVWYQGESNINYNTDLYNCTFPALIEDW RETFHRGSQGQTERFFPFGLVQLSSDLSKKSSDDGFPQIRWHQTADFGYV PNPKMPNTFMAVAMDLCDRDSPFGSIHPRDKQTVAYRLHLGARALAYGEK NLTFEGPLPEKIELLAHKGLLNLTYYQQIQVQKKDNKIFEISCCSDHRCK WLPASMNTVSTQSLTLAIDSCHGTVVALRYAWTTWPCEYKQCPLYHPSSA LPAPPFIAFITDQGPGHQSNVAK
    • Amino acids

      1 to 523
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162734 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CSE C
    • CSEC
    • Cytosolic sialic acid 9 O acetylesterase homolog
    • H Lse
    • HLse
    • LSE
    • MGC87009
    • Sialate O acetylesterase
    • Sialic acid acetylesterase
    • Sialic acid specific 9 O acetylesterase
    • Sialic acid specific acetylesterase II
    • YSG2
    • Ysg2 homolog
    see all
  • Relevance

    Sialic acids are acidic 9-carbon sugars typically found at the non-reducing end of sugar chains. They are frequently modified by 9-O-acetylation and this modification is removed by sialic acid acetylesterases. SIAE catalyzes the removal of O-acetyl ester groups from position 9 of the parent sialic acid, N-acetylneuraminic acid. SIAE appears to encode both lysosomal and cytosolic sialic acid acetylesterase isoforms (LSE and CSE, respectively). It is widely expressed with high expression in the testis, prostate, and colon. There are three named isoforms.
  • Cellular localization

    Lysosome

Images

  • ab162734 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162734 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162734.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up