Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RSCRKKSARPAADVGDIGMKDANTIRGSASQGNLTESWADDNPRHHGLAA HSSGEEREIQYAPLSFHKGEPQDLSGQEATNNEYSEIKIP
    • Amino acids
      377 to 466
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162061 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Adhesion inhibitory receptor molecule 1
    • Adhesion inhibitory receptor molecule 1, siglec 7
    • AIRM 1
    • AIRM-1
    • AIRM1
    • CD328
    • CD328 antigen
    • CDw328
    • D siglec
    • D-siglec
    • HLDA 8
    • p75
    • p75/AIRM1
    • QA79
    • QA79 membrane protein
    • Sialic acid binding Ig like lectin 7
    • Sialic acid binding immunoglobulin like lectin 7
    • Sialic acid-binding Ig-like lectin 7
    • SIGL7_HUMAN
    • Siglec-7
    • SIGLEC19P
    • SIGLEC7
    • SIGLECP2
    see all
  • Function
    Putative adhesion molecule that mediates sialic-acid dependent binding to cells. Preferentially binds to alpha-2,3- and alpha-2,6-linked sialic acid. Also binds disialogangliosides (disialogalactosyl globoside, disialyl lactotetraosylceramide and disialyl GalNAc lactotetraoslylceramide). The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. In the immune response, may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules. Mediates inhibition of natural killer cells cytotoxicity. May play a role in hemopoiesis. Inhibits differentiation of CD34+ cell precursors towards myelomonocytic cell lineage and proliferation of leukemic myeloid cells (in vitro).
  • Tissue specificity
    Predominantly expressed by resting and activated natural killer cells and at lower levels by granulocytes and monocytes. High expression found in placenta, liver, lung, spleen, and peripheral blood leukocytes.
  • Sequence similarities
    Belongs to the immunoglobulin superfamily. SIGLEC (sialic acid binding Ig-like lectin) family.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Domain
    Contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases.
  • Post-translational
    modifications
    Tyrosine phosphorylated.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab162061 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162061 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162061.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up