Recombinant Human Siglec 7 protein (Fc Chimera His Tag) (ab223026)

Description

  • Product name

    Recombinant Human Siglec 7 protein (Fc Chimera His Tag)
  • Purity

    > 90 % SDS-PAGE.
    ab223026 was purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ADPQKSNRKDYSLTMQSSVTVQEGMCVHVRCSFSYPVDSQTDSDPVHGYW FRAGNDISWKAPVATNNPAWAVQEETRDRFHLLGDPQTKNCTLSIRDARM SDAGRYFFRMEKGNIKWNYKYDQLSVNVTALTHRPNILIPGTLESGCFQN LTCSVPWACEQGTPPMISWMGTSVSPLHPSTTRSSVLTLIPQPQHHGTSL TCQVTLPGAGVTTNRTIQLNVSYPPQNLTVTVFQGEGTASTALGNSSSLS VLEGQSLRLVCAVDSNPPARLSWTWRSLTLYPSQPSNPLVLELQVHLGDE GEFTCRAQNSLGSQHVSLNLSLQQEYTGKMRPVSGVLLLEPKSCDKTHTC PPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFN WYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNK ALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSD IAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCS VMHEALHNHYTQKSLSLSPGKHHHHHH
    • Predicted molecular weight

      64 kDa including tags
    • Amino acids

      19 to 353
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain fused to hlgG-His-tag at C-terminus (NP_055200).

Specifications

Our Abpromise guarantee covers the use of ab223026 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 10% Glycerol, PBS

General Info

  • Alternative names

    • Adhesion inhibitory receptor molecule 1
    • Adhesion inhibitory receptor molecule 1, siglec 7
    • AIRM 1
    • AIRM-1
    • AIRM1
    • CD328
    • CD328 antigen
    • CDw328
    • D siglec
    • D-siglec
    • HLDA 8
    • p75
    • p75/AIRM1
    • QA79
    • QA79 membrane protein
    • Sialic acid binding Ig like lectin 7
    • Sialic acid binding immunoglobulin like lectin 7
    • Sialic acid-binding Ig-like lectin 7
    • SIGL7_HUMAN
    • Siglec-7
    • SIGLEC19P
    • SIGLEC7
    • SIGLECP2
    see all
  • Function

    Putative adhesion molecule that mediates sialic-acid dependent binding to cells. Preferentially binds to alpha-2,3- and alpha-2,6-linked sialic acid. Also binds disialogangliosides (disialogalactosyl globoside, disialyl lactotetraosylceramide and disialyl GalNAc lactotetraoslylceramide). The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. In the immune response, may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules. Mediates inhibition of natural killer cells cytotoxicity. May play a role in hemopoiesis. Inhibits differentiation of CD34+ cell precursors towards myelomonocytic cell lineage and proliferation of leukemic myeloid cells (in vitro).
  • Tissue specificity

    Predominantly expressed by resting and activated natural killer cells and at lower levels by granulocytes and monocytes. High expression found in placenta, liver, lung, spleen, and peripheral blood leukocytes.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. SIGLEC (sialic acid binding Ig-like lectin) family.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Domain

    Contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases.
  • Post-translational
    modifications

    Tyrosine phosphorylated.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab223026.

    MWt: 70-100kDa (under reducing conditions).

References

ab223026 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223026.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up