Overview

  • Product name

    Recombinant Human SIGLEC10 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      SRHSTILDYINVVPTAGPLAQKRNQKATPNSPRTPLPPGAPSPESKKNQK KQYQLPSFPEPKSSTQAPESQESQEELHYATLNFPGVRPRPEARMPKGTQ ADYAEVKF
    • Amino acids

      589 to 696
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164780 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • mSiglec G
    • PRO940
    • Sialic acid binding Ig like lectin 10
    • sialic acid binding Ig like lectin 10 Ig like lectin 7
    • sialic acid binding Ig like lectin G
    • Sialic acid binding Immunoglobulin like lectin 10
    • Sialic acid-binding Ig-like lectin 10
    • SIG10_HUMAN
    • SIGLEC 10
    • Siglec G
    • siglec like gene 2
    • Siglec like protein 2
    • Siglec-10
    • Siglec-like protein 2
    • SIGLEC10
    • Siglecg
    • SLG2
    see all
  • Function

    Putative adhesion molecule that mediates sialic-acid dependent binding to cells. Preferentially binds to alpha-2,3- or alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. In the immune response, may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules.
  • Tissue specificity

    Expressed by peripheral blood leukocytes (eosinophils, monocytes and a natural killer cell subpopulation). Isoform 5 is found to be the most abundant isoform. Found in lymph node, lung, ovary and appendix. Isoform 1 is found at high levels and isoform 2 at lower levels in bone marrow, spleen and spinal chord. Isoform 2 is also found in brain. Isoform 4 is specifically found in natural killer cells.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. SIGLEC (sialic acid binding Ig-like lectin) family.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Domain

    Contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases.
  • Post-translational
    modifications

    Phosphorylation of Tyr-667 is involved in binding to PTPN6.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt

Images

  • ab164780 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164780 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164780.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up