Recombinant Human SIGLEC15 protein (His tag) (ab239576)

Description

  • Product name

    Recombinant Human SIGLEC15 protein (His tag)
    See all SIGLEC15 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Mammalian
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHP HRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGN PRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPR IVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHG HLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST
    • Predicted molecular weight

      31 kDa including tags
    • Amino acids

      20 to 263
    • Tags

      His tag N-Terminus
    • Additional sequence information

      N-terminal 6xHis-tagged. Extracellular domain.

Specifications

Our Abpromise guarantee covers the use of ab239576 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

General Info

  • Alternative names

    • CD33 antigen-like 3
    • CD33 molecule-like 3
    • CD33L3
    • HsT1361
    • Sialic acid-binding Ig-like lectin 15
    • SIG15_HUMAN
    • Siglec-15
    • SIGLEC15
    see all
  • Function

    Binds sialylated glycoproteins.
  • Tissue specificity

    Expressed in macrophage and/or dendritic cells of spleen and lymph nodes.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. SIGLEC (sialic acid binding Ig-like lectin) family.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel analysis of ab239576.

References

ab239576 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239576.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up