Description

  • Product name

    Recombinant Human SIGLEC8 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      EGDRQYGDGYLLQVQELVTVQEGLCVHVPCSFSYPQDGWTDSDPVHGYWF RAGDRPYQDAPVATNNPDREVQAETQGRFQLLGDIWSNDCSLSIRDARKR DKGS
    • Amino acids

      18 to 121
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162108 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CD329 antigen
    • CDw329
    • SAF 2
    • SAF-2
    • SAF2
    • Sialic acid binding Ig like lectin 8
    • Sialic acid-binding Ig-like lectin 8
    • Sialoadhesin family member 2
    • SIGL8_HUMAN
    • Siglec 8
    • Siglec-8
    • SIGLEC8
    • SIGLEC8L
    see all
  • Function

    Putative adhesion molecule that mediates sialic-acid dependent binding to cells. Preferentially binds to alpha-2,3-linked sialic acid. Also binds to alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface.
  • Tissue specificity

    Expressed specifically on eosinophils.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. SIGLEC (sialic acid binding Ig-like lectin) family.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Domain

    Contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab162108 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162108 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162108.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up