Overview

  • Product name
    Recombinant Human Sigma1-receptor protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYA GLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASL SEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGE TVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLF YTLRSYARGLRLELTTYLFGQDP
    • Amino acids
      1 to 223
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160924 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/mL.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Aging associated gene 8 protein
    • Aging-associated gene 8 protein
    • AL024364
    • hSigmaR1
    • mSigmaR1
    • opioid receptor, sigma 1
    • opioid receptor, sigma 1 isoform 1
    • RP23 167I12.6
    • SGMR1_HUMAN
    • SIG 1R
    • SIG-1R
    • Sigma 1-type opioid receptor
    • Sigma non-opioid intracellular receptor 1
    • sigma1 receptor
    • Sigma1-receptor
    • Sigma1R
    • Sigmar1
    • SR BP
    • SR-BP
    • SR31747 binding protein
    • SR31747-binding protein
    • SRBP
    see all
  • Function
    Functions in lipid transport from the endoplasmic reticulum and is involved in a wide array of cellular functions probably through regulation of the biogenesis of lipid microdomains at the plasma membrane. Involved in the regulation of different receptors it plays a role in BDNF signaling and EGF signaling. Also regulates ion channels like the potassium channel and could modulate neurotransmitter release. Plays a role in calcium signaling through modulation together with ANK2 of the ITP3R-dependent calcium efflux at the endoplasmic reticulum. Plays a role in several other cell functions including proliferation, survival and death. Originally identified for its ability to bind various psychoactive drugs it is involved in learning processes, memory and mood alteration.
  • Tissue specificity
    Widely expressed with higher expression in liver, colon, prostate, placenta, small intestine, heart and pancreas. Expressed in the retina by retinal pigment epithelial cells.
  • Involvement in disease
    Amyotrophic lateral sclerosis 16, juvenile
  • Sequence similarities
    Belongs to the ERG2 family.
  • Cellular localization
    Nucleus inner membrane. Nucleus outer membrane. Endoplasmic reticulum membrane. Lipid droplet. Cell junction. Cell membrane. Cell projection > growth cone. Targeted to lipid droplets, cholesterol and galactosylceramide-enriched domains of the endoplasmic reticulum. Enriched at cell-cell communication regions, growth cone and postsynaptic structures. Localization is modulated by ligand-binding.
  • Information by UniProt

Images

  • ab160924 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

This product has been referenced in:
  • Gao W  et al. Plasma membrane proteomic analysis of human Gastric Cancer tissues: revealing flotillin 1 as a marker for Gastric Cancer. BMC Cancer 15:367 (2015). WB . Read more (PubMed: 25948494) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160924.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up