Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      AHAFEAFQSTRSGQRRHTLSEVTNQLVVMPGAGKIFSMNDSPSLDSVDSE YDMGSVQRDLNFLEDNPSLKDIMLANQPSPRMTSPFISLRPTNPAMQALS SQKREVHNRS
    • Amino acids

      467 to 576
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153212 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as Snf1lk2, Snf1lk+Snf1lk2+SIK3

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DKFZp434K1115
    • EC 2.7.11.1
    • KIAA0781
    • LOH11CR1I
    • QIK
    • Qin induced kinase
    • Qin-induced kinase
    • Salt inducible kinase 2
    • Salt inducible protein kinase 2
    • Salt inducible serine/threonine kinase 2
    • Salt-inducible protein kinase 2
    • Serine/threonine protein kinase SIK2
    • Serine/threonine protein kinase SNF1 like kinase 2
    • Serine/threonine-protein kinase SIK2
    • Serine/threonine-protein kinase SNF1-like kinase 2
    • SIK 2
    • SIK-2
    • SIK2
    • SIK2_HUMAN
    • SNF1 like kinase
    • SNF1 like kinase 2
    • SNF1LK2
    see all
  • Function

    Phosphorylates 'Ser-794' of IRS1 in insulin-stimulated adipocytes, potentially modulating the efficiency of insulin signal transduction. Inhibits CREB activity by phosphorylating and repressing TORCs, the CREB-specific coactivators.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. AMPK subfamily.
    Contains 1 protein kinase domain.
    Contains 1 UBA domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • ab153212 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153212 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153212.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up