Overview

  • Product name

    Recombinant human SIK3 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MPARIGYYEIDRTIGKGNFAVVKRATHLVTKAKVAIKIIDKTQLDEENLK KIFREVQIMKMLCHPHIIRLYQVMETERMIYLVTEYASGGEIFDHLVAHG RMAEKEARRKFKQIVTAVYFCHCRNIVHRDLKAENLLLDANLNIKIADFG FSNLFTPGQLLKTWCGSPPYAAPELFEGKEYDGPKVDIWSLGVVLYVLVC GALPFDGSTLQNLRARVLSGKFRIPFFMSTECEHLIRHMLVLDPNKRLSM EQICKHKWMKLGDADPNFDRLIAECQQLKEERQVDPLNEDVLLAMEDMGL DKEQTLQ
    • Molecular weight

      62 kDa including tags
    • Amino acids

      1 to 307
    • Tags

      GST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab136351 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    The specific activity of ab136351 was determined to be 140 nmol/min/mg.
  • Applications

    Western blot

    Functional Studies

    SDS-PAGE

  • Purity

    > 90 % Densitometry.

  • Form

    Liquid
  • Additional notes

    ab204852 (AMARA substrate peptide for SIK + AMPK) can be utilized as a substrate for assessing kinase activity

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.31% Glutathione, 0.002% PMSF, 0.004% DTT, 0.79% Tris HCl, 0.003% EDTA, 25% Glycerol, 0.88% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • FLJ12240
    • KIAA0999
    • L19
    • QSK
    • Salt inducible kinase 3
    • serine/threonine-protein kinase QSK
    • Serine/threonine-protein kinase SIK3
    • SIK 3
    • SIK family kinase 3
    • SIK3_HUMAN
    see all
  • Relevance

    Activated by phosphorylation on Thr 163 by STK11 in complex with STE20 related adapter alpha (STRAD alpha) pseudo kinase and CAB39. Binds to and is activated by YWHAZ when phosphorylated on Thr 163.
  • Cellular localization

    Cytoplasm

Images

  • SDS-PAGE analysis of ab136351.
  • The specific activity of ab136351 was determined to be 140 nmol/min/mg.

References

ab136351 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab136351.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up