Bioactive grade

Recombinant human SIRP alpha protein (Active) (Biotin) (ab246052)

Description

  • Product name

    Recombinant human SIRP alpha protein (Active) (Biotin)
    See all SIRP alpha proteins and peptides
  • Biological activity

    Assay 1: Immobilized Human CD47, His Tag at 5 μg/mL (100 μL/well) can bind ab246052 with a linear range of 5-205 ng/mL (QC tested).

    Assay 2: FACS assay shows thatab246052 can bind to Jurkat cell expressing CD47. The concentration of SIRP alpha used is 0.3 ug/ml (Routinely tested).

    Assay 3: FACS analysis shows that the binding ofab246052 to Jurkat expressing CD47 was inhibited by increasing concentration of neutralizing anti-CD47 antibody. The concentration of SIRP alpha used is 1 ug/ml. IC50=0.1303 ug/ml (Routinely tested).

  • Purity

    > 95 % SDS-PAGE.
    The biotin to protein ratio is 0.5-1 as determined by the HABA assay.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      EEELQVIQPDKSVLVAAGETATLRCTATSLIPVGPIQWFRGAGPGRELIY NQKEGHFPRVTTVSDLTKRNNMDFSIRIGNITPADAGTYYCVKFRKGSPD DVEFKSGAGTELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDI TLKWFKNGNELSDFQTNVDPVGESVSYSIHSTAKVVLTREDVHSQVICEV AHVTLQGDPLRGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVRKFYP QRLQLTWLENGNVSRTETASTVTENKDGTYNWMSWLLVNVSAHRDDVKLT CQVEHDGQPAVSKSHDLKVSAHPKEQGSNTAAENTGSNER
    • Predicted molecular weight

      66 kDa including tags
    • Amino acids

      31 to 370
    • Tags

      Avi tag C-Terminus , Fc tag C-Terminus
    • Additional sequence information

      Biotinylation of this product is performed using Avitag™ technology. Briefly, the single lysine residue in the Avitag is enzymatically labeled with biotin. Avitag™ sequence GLNDIFEAQKIEWHE.
  • Conjugation

    Biotin

Specifications

Our Abpromise guarantee covers the use of ab246052 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle. Store In the Dark.

    pH: 7.50
    Constituents: 5% Trehalose, 0.75% Glycine, 0.61% Tris buffer

    0.22 µm filtered

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long-term storage.

General Info

  • Alternative names

    • Signal regulatory protein alpha type 1
    • Bit
    • Brain Ig like molecule with tyrosine based activation motifs
    • Brain Ig-like molecule with tyrosine-based activation motifs
    • Brain immunoglobulin like molecule with tyrosine based activation motifs
    • CD172 antigen like family member A
    • CD172 antigen-like family member A
    • CD172a
    • CD172a antigen
    • Inhibitory receptor SHPS-1
    • Macrophage fusion receptor
    • MFR
    • MYD 1
    • Myd 1 antigen
    • MyD-1 antigen
    • p84
    • Protein tyrosine phosphatase non receptor type substrate 1
    • PTPNS1
    • SHP substrate 1
    • SHPS-1
    • SHPS1
    • SHPS1_HUMAN
    • Signal regulatory protein alpha
    • Signal regulatory protein alpha 2
    • Signal regulatory protein alpha 3
    • Signal regulatory protein alpha type 2
    • Signal-regulatory protein alpha-1
    • Signal-regulatory protein alpha-2
    • Signal-regulatory protein alpha-3
    • SIRP
    • Sirp-alpha-1
    • Sirp-alpha-2
    • Sirp-alpha-3
    • SIRPA
    • SIRPalpha
    • SIRPalpha1
    • SIRPalpha2
    • SIRPalpha3
    • Tyrosine phosphatase SHP substrate 1
    • Tyrosine protein phosphatase non receptor type substrate 1
    • Tyrosine-protein phosphatase non-receptor type substrate 1
    see all
  • Function

    Immunoglobulin-like cell surface receptor for CD47. Acts as docking protein and induces translocation of PTPN6, PTPN11 and other binding partners from the cytosol to the plasma membrane. Supports adhesion of cerebellar neurons, neurite outgrowth and glial cell attachment. May play a key role in intracellular signaling during synaptogenesis and in synaptic function (By similarity). Involved in the negative regulation of receptor tyrosine kinase-coupled cellular responses induced by cell adhesion, growth factors or insulin. Mediates negative regulation of phagocytosis, mast cell activation and dendritic cell activation. CD47 binding prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells.
  • Tissue specificity

    Ubiquitous. Highly expressed in brain. Detected on myeloid cells, but not T-cells. Detected at lower levels in heart, placenta, lung, testis, ovary, colon, liver, small intestine, prostate, spleen, kidney, skeletal muscle and pancreas.
  • Sequence similarities

    Contains 2 Ig-like C1-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Post-translational
    modifications

    N-glycosylated.
    Phosphorylated on tyrosine residues in response to stimulation with EGF, growth hormone, insulin and PDGF. Dephosphorylated by PTPN11.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • SDS-page analysis  ab246052 under reducing conditions. The gel was stained overnight with coomassie blue. The protein has a calculated MW of 65.8 kDa. The protein migrates as 75-105 kDa under reducing conditions (SDS-PAGE) due to glycosylation.

  • FACS assay shows that ab246052 can bind to Jurkat (human T cell leukemia cell line from peripheral blood) cells expressing CD47. The concentration of SIRP alpha used is 0.3 ug/ml (Routinely tested).

  • FACS analysis shows that the binding of ab246052 to Jurkat (human T cell leukemia cell line from peripheral blood) cells expressing CD47 was inhibited by increasing concentration of neutralizing anti-CD47 antibody. The concentration of ab246052 used is 1 ug/ml. IC50=0.1303 ug/ml (Routinely tested).

  • Immobilized Human CD47, His Tag at 5 μg/mL (100 μL/well) can bind ab246052 with a linear range of 5-205 ng/mL (QC tested).

References

ab246052 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246052.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up