Description

  • Product name

    Recombinant Human SIRP alpha protein (Fc Chimera)
    See all SIRP alpha proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      EEELQVIQPDKSVSVAAGESAILHCTVTSLIPVGPIQWFRGAGPARELIY NQKEGHFPRVTTVSESTKRENMDFSISISNITPADAGTYYCVKFRKGSPD TEFKSGAGTELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDIT LKWFKNGNELSDFQTNVDPVGESVSYSIHSTAKVVLTREDVHSQVICEVA HVTLQGDPLRGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVRKFYPQ RLQLTWLENGNVSRTETASTVTENKDGTYNWMSWLLVNVSAHRDDVKLTC QVEHDGQPAVSKSHDLKVSAHPKEQGSNTAAENTGSNERDIEGRMDEPKS CDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEY KCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLV KGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ GNVFSCSVMHEALHNHYTQKSLSLSPGK
    • Predicted molecular weight

      64 kDa including tags
    • Amino acids

      31 to 370
    • Additional sequence information

      Expressed with a Fc tag at the C-terminus.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab217557 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    Lyophilized from a 0.2 µm filtered solution.

  • Reconstitution
    Dissolve the lyophilized protein in ddH2O. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Always centrifuge tubes before opening. Do not mix by vortex or pipetting.

General Info

  • Alternative names

    • Signal regulatory protein alpha type 1
    • Bit
    • Brain Ig like molecule with tyrosine based activation motifs
    • Brain Ig-like molecule with tyrosine-based activation motifs
    • Brain immunoglobulin like molecule with tyrosine based activation motifs
    • CD172 antigen like family member A
    • CD172 antigen-like family member A
    • CD172a
    • CD172a antigen
    • Inhibitory receptor SHPS-1
    • Macrophage fusion receptor
    • MFR
    • MYD 1
    • Myd 1 antigen
    • MyD-1 antigen
    • p84
    • Protein tyrosine phosphatase non receptor type substrate 1
    • PTPNS1
    • SHP substrate 1
    • SHPS-1
    • SHPS1
    • SHPS1_HUMAN
    • Signal regulatory protein alpha
    • Signal regulatory protein alpha 2
    • Signal regulatory protein alpha 3
    • Signal regulatory protein alpha type 2
    • Signal-regulatory protein alpha-1
    • Signal-regulatory protein alpha-2
    • Signal-regulatory protein alpha-3
    • SIRP
    • Sirp-alpha-1
    • Sirp-alpha-2
    • Sirp-alpha-3
    • SIRPA
    • SIRPalpha
    • SIRPalpha1
    • SIRPalpha2
    • SIRPalpha3
    • Tyrosine phosphatase SHP substrate 1
    • Tyrosine protein phosphatase non receptor type substrate 1
    • Tyrosine-protein phosphatase non-receptor type substrate 1
    see all
  • Function

    Immunoglobulin-like cell surface receptor for CD47. Acts as docking protein and induces translocation of PTPN6, PTPN11 and other binding partners from the cytosol to the plasma membrane. Supports adhesion of cerebellar neurons, neurite outgrowth and glial cell attachment. May play a key role in intracellular signaling during synaptogenesis and in synaptic function (By similarity). Involved in the negative regulation of receptor tyrosine kinase-coupled cellular responses induced by cell adhesion, growth factors or insulin. Mediates negative regulation of phagocytosis, mast cell activation and dendritic cell activation. CD47 binding prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells.
  • Tissue specificity

    Ubiquitous. Highly expressed in brain. Detected on myeloid cells, but not T-cells. Detected at lower levels in heart, placenta, lung, testis, ovary, colon, liver, small intestine, prostate, spleen, kidney, skeletal muscle and pancreas.
  • Sequence similarities

    Contains 2 Ig-like C1-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Post-translational
    modifications

    N-glycosylated.
    Phosphorylated on tyrosine residues in response to stimulation with EGF, growth hormone, insulin and PDGF. Dephosphorylated by PTPN11.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab217557.

    Lane 1: Reduced sample.

    Lane 2: Non reduced sample.

     

References

ab217557 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217557.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up