Bioactive grade

Recombinant human SIRP alpha protein (Fc Chimera Active) (ab221235)

Submit a review Submit a question

Key features and details

  • Expression system: HEK 293 cells
  • Purity: > 95% SDS-PAGE
  • Endotoxin level: < 1.000 Eu/µg
  • Active: Yes
  • Suitable for: SDS-PAGE, HPLC, Functional Studies

Description

  • Product name

    Recombinant human SIRP alpha protein (Fc Chimera Active)
    See all SIRP alpha proteins and peptides

  • Biological activity

    Measured by its binding ability in a functional ELISA. Immobilized ab221235 at 2 μg/mL (100 μL/well) can bind Human CD47, His Tag with a linear range of 1.56-12.5 ng/mL.

  • Purity

    > 95 % SDS-PAGE.
    >90% pure as determined by SEC-HPLC.

  • Endotoxin level

    < 1.000 Eu/µg

  • Expression system

    HEK 293 cells

  • Accession

    P78324

  • Protein length

    Protein fragment

  • Animal free

    No

  • Nature

    Recombinant

    • Species

      Human

    • Sequence

      EEELQVIQPDKSVLVAAGETATLRCTATSLIPVGPIQWFRGAGPGRELIY NQKEGHFPRVTTVSDLTKRNNMDFSIRIGNITPADAGTYYCVKFRKGSPD DVEFKSGAGTELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDI TLKWFKNGNELSDFQTNVDPVGESVSYSIHSTAKVVLTREDVHSQVICEV AHVTLQGDPLRGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVRKFYP QRLQLTWLENGNVSRTETASTVTENKDGTYNWMSWLLVNVSAHRDDVKLT CQVEHDGQPAVSKSHDLKVSAHPKEQGSNTAAENTGSNER

    • Predicted molecular weight

      64 kDa including tags

    • Amino acids

      31 to 370

    • Additional sequence information

      Extracellular domain; Accession # NP_001035111. This protein carries a Human IgG1 Fc tag at the C-terminus (Pro 100- Lys 330; P01857)

Associated products

Specifications

Our Abpromise guarantee covers the use of ab221235 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

    Functional Studies

  • Form

    Lyophilized
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.61% Tris, 0.75% Glycine, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with sterile deionized water to a concentration of 400 µg/ml.

General Info

  • Alternative names

    • Signal regulatory protein alpha type 1
    • Bit
    • Brain Ig like molecule with tyrosine based activation motifs
    • Brain Ig-like molecule with tyrosine-based activation motifs
    • Brain immunoglobulin like molecule with tyrosine based activation motifs
    • CD172 antigen like family member A
    • CD172 antigen-like family member A
    • CD172a
    • CD172a antigen
    • Inhibitory receptor SHPS-1
    • Macrophage fusion receptor
    • MFR
    • MYD 1
    • Myd 1 antigen
    • MyD-1 antigen
    • p84
    • Protein tyrosine phosphatase non receptor type substrate 1
    • PTPNS1
    • SHP substrate 1
    • SHPS-1
    • SHPS1
    • SHPS1_HUMAN
    • Signal regulatory protein alpha
    • Signal regulatory protein alpha 2
    • Signal regulatory protein alpha 3
    • Signal regulatory protein alpha type 2
    • Signal-regulatory protein alpha-1
    • Signal-regulatory protein alpha-2
    • Signal-regulatory protein alpha-3
    • SIRP
    • Sirp-alpha-1
    • Sirp-alpha-2
    • Sirp-alpha-3
    • SIRPA
    • SIRPalpha
    • SIRPalpha1
    • SIRPalpha2
    • SIRPalpha3
    • Tyrosine phosphatase SHP substrate 1
    • Tyrosine protein phosphatase non receptor type substrate 1
    • Tyrosine-protein phosphatase non-receptor type substrate 1
    see all

  • Function

    Immunoglobulin-like cell surface receptor for CD47. Acts as docking protein and induces translocation of PTPN6, PTPN11 and other binding partners from the cytosol to the plasma membrane. Supports adhesion of cerebellar neurons, neurite outgrowth and glial cell attachment. May play a key role in intracellular signaling during synaptogenesis and in synaptic function (By similarity). Involved in the negative regulation of receptor tyrosine kinase-coupled cellular responses induced by cell adhesion, growth factors or insulin. Mediates negative regulation of phagocytosis, mast cell activation and dendritic cell activation. CD47 binding prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells.

  • Tissue specificity

    Ubiquitous. Highly expressed in brain. Detected on myeloid cells, but not T-cells. Detected at lower levels in heart, placenta, lung, testis, ovary, colon, liver, small intestine, prostate, spleen, kidney, skeletal muscle and pancreas.

  • Sequence similarities

    Contains 2 Ig-like C1-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.

  • Post-translational
    modifications

    N-glycosylated.
    Phosphorylated on tyrosine residues in response to stimulation with EGF, growth hormone, insulin and PDGF. Dephosphorylated by PTPN11.

  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ELISA - Recombinant human SIRP alpha protein (Fc Chimera Active) (ab221235)
    ELISA - Recombinant human SIRP alpha protein (Fc Chimera Active) (ab221235)

    Immobilized ab221235 at 2 μg/mL (100 μL/well) can bind Human CD47, His Tag with a linear range of 1.56-12.5 ng/mL.

  • Functional Studies - Recombinant human SIRP alpha protein (Fc Chimera Active) (ab221235)
    Functional Studies - Recombinant human SIRP alpha protein (Fc Chimera Active) (ab221235)
    The purity of Human SIRP alpha, Fc Tag (HPLC-verified) was greater than 90% as determined by SEC-HPLC.
  • Functional Studies - Recombinant human SIRP alpha protein (Fc Chimera Active) (ab221235)
    Functional Studies - Recombinant human SIRP alpha protein (Fc Chimera Active) (ab221235)
    FACS assay shows that recombinant Human SIRP alpha, Fc Tag (HPLC-verified) can bind to Jurkat cell expressing CD47. The concentration of SIRP alpha used is 1 µg/ml.
  • SDS-PAGE - Recombinant human SIRP alpha protein (Fc Chimera Active) (ab221235)
    SDS-PAGE - Recombinant human SIRP alpha protein (Fc Chimera Active) (ab221235)
    Human SIRP alpha, Fc Tag (HPLC-verified) on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%.
  • SDS-PAGE - Recombinant human SIRP alpha protein (Fc Chimera Active) (ab221235)
    SDS-PAGE - Recombinant human SIRP alpha protein (Fc Chimera Active) (ab221235)

    SDS-PAGE analysis of ab221235 under reducing conditions, stained overnight with Coomassie Blue. As a result of glycosylation, the reduced protein migrates as 70-105 kDa.

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

References (0)

Publishing research using ab221235? Please let us know so that we can cite the reference in this datasheet.

ab221235 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab221235.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com