Recombinant human SIRP alpha protein (Fc Chimera Active) (ab221235)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Suitable for: SDS-PAGE, HPLC, Functional Studies
Description
-
Product name
Recombinant human SIRP alpha protein (Fc Chimera Active)
See all SIRP alpha proteins and peptides -
Biological activity
Measured by its binding ability in a functional ELISA. Immobilized ab221235 at 2 μg/mL (100 μL/well) can bind Human CD47, His Tag with a linear range of 1.56-12.5 ng/mL.
-
Purity
> 95 % SDS-PAGE.
>90% pure as determined by SEC-HPLC. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
EEELQVIQPDKSVLVAAGETATLRCTATSLIPVGPIQWFRGAGPGRELIY NQKEGHFPRVTTVSDLTKRNNMDFSIRIGNITPADAGTYYCVKFRKGSPD DVEFKSGAGTELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDI TLKWFKNGNELSDFQTNVDPVGESVSYSIHSTAKVVLTREDVHSQVICEV AHVTLQGDPLRGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVRKFYP QRLQLTWLENGNVSRTETASTVTENKDGTYNWMSWLLVNVSAHRDDVKLT CQVEHDGQPAVSKSHDLKVSAHPKEQGSNTAAENTGSNER -
Predicted molecular weight
64 kDa including tags -
Amino acids
31 to 370 -
Additional sequence information
Extracellular domain; Accession # NP_001035111. This protein carries a Human IgG1 Fc tag at the C-terminus (Pro 100- Lys 330; P01857)
-
Specifications
Our Abpromise guarantee covers the use of ab221235 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
HPLC
Functional Studies
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.4
Constituents: 0.61% Tris, 0.75% Glycine, 5% Trehalose
Lyophilized from 0.22 µm filtered solution.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with sterile deionized water to a concentration of 400 µg/ml.
General Info
-
Alternative names
- Signal regulatory protein alpha type 1
- Bit
- Brain Ig like molecule with tyrosine based activation motifs
see all -
Function
Immunoglobulin-like cell surface receptor for CD47. Acts as docking protein and induces translocation of PTPN6, PTPN11 and other binding partners from the cytosol to the plasma membrane. Supports adhesion of cerebellar neurons, neurite outgrowth and glial cell attachment. May play a key role in intracellular signaling during synaptogenesis and in synaptic function (By similarity). Involved in the negative regulation of receptor tyrosine kinase-coupled cellular responses induced by cell adhesion, growth factors or insulin. Mediates negative regulation of phagocytosis, mast cell activation and dendritic cell activation. CD47 binding prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. -
Tissue specificity
Ubiquitous. Highly expressed in brain. Detected on myeloid cells, but not T-cells. Detected at lower levels in heart, placenta, lung, testis, ovary, colon, liver, small intestine, prostate, spleen, kidney, skeletal muscle and pancreas. -
Sequence similarities
Contains 2 Ig-like C1-type (immunoglobulin-like) domains.
Contains 1 Ig-like V-type (immunoglobulin-like) domain. -
Post-translational
modificationsN-glycosylated.
Phosphorylated on tyrosine residues in response to stimulation with EGF, growth hormone, insulin and PDGF. Dephosphorylated by PTPN11. -
Cellular localization
Membrane. - Information by UniProt
Images
-
Immobilized ab221235 at 2 μg/mL (100 μL/well) can bind Human CD47, His Tag with a linear range of 1.56-12.5 ng/mL.
-
The purity of Human SIRP alpha, Fc Tag (HPLC-verified) was greater than 90% as determined by SEC-HPLC.
-
FACS assay shows that recombinant Human SIRP alpha, Fc Tag (HPLC-verified) can bind to Jurkat cell expressing CD47. The concentration of SIRP alpha used is 1 µg/ml.
-
Human SIRP alpha, Fc Tag (HPLC-verified) on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%.
-
SDS-PAGE analysis of ab221235 under reducing conditions, stained overnight with Coomassie Blue. As a result of glycosylation, the reduced protein migrates as 70-105 kDa.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab221235 has not yet been referenced specifically in any publications.