Description

  • Product name

    Recombinant Human SIRPB1 protein
    See all SIRPB1 proteins and peptides
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MPVPASWPHLPSPFLLMTLLLGRLTGVAGEDELQVIQPEKSVSVAAGESA TLRCAMTSLIPVGPIMWFRGAGAGRELIYNQKEGHFPRVTTVSELTKRNN LDFSISISNITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSVREPALAP TAPLLVALLLGPKLLLVVGVSAIYICWKQKA
    • Amino acids

      1 to 181
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160947 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as SIRP beta 1/CD172b

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CD172 antigen like family member B
    • CD172b
    • CD172b antigen
    • DKFZp686A05192
    • Signal regulatory protein beta 1
    • SIRP BETA 1
    • SIRP beta 1 isoform 3
    see all
  • Relevance

    The protein encoded by the SIRPß1 gene is a member of the signal-regulatory-protein (SIRP) family, and also belongs to the immunoglobulin superfamily. SIRP family members are receptor-type transmembrane glycoproteins which are known to be involved in the negative regulation of receptor tyrosine kinase-coupled signaling processes. SIRPß1 was found to interact with TYROBP/DAP12, a protein bearing immunoreceptor tyrosine-based activation motifs. This protein was also reported to participate in the recruitment of tyrosine kinase SYK. Multiple transcript variants encoding different isoforms have been found for this gene.
  • Cellular localization

    Cell Membrane; single-pass type I membrane protein

Images

  • ab160947 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160947 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160947.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up