Description

  • Product name

    Recombinant Human SIRPB1 protein (His tag)
    See all SIRPB1 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab235876 was expressed in insect cell and purified by using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      EDELQVIQPEKSVSVAAGESATLRCAMTSLIPVGPIMWFRGAGAGRELIY NQKEGHFPRVTTVSELTKRNNLDFSISISNITPADAGTYYCVKFRKGSPD DVEFKSGAGTELSVRAKPSAPVVSGPAVRATPEHTVSFTCESHGFSPRDI TLKWFKNGNELSDFQTNVDPAGDSVSYSIHSTARVVLTRGDVHSQVICEI AHITLQGDPLRGTANLSEAIRVPPTLEVTQQPMRAENQANVTCQVSNFYP RGLQLTWLENGNVSRTETASTLIENKDGTYNWMSWLLVNTCAHRDDVVLT CQVEHDGQQAVSKSYALEISAHQKEHGSDITHEAALAPTAPLHHHHHH
    • Predicted molecular weight

      38 kDa including tags
    • Amino acids

      30 to 371
    • Tags

      His tag C-Terminus
    • Additional sequence information

      NP_006056. Extracellular domain.

Specifications

Our Abpromise guarantee covers the use of ab235876 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as SIRP beta 1/CD172b

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: PBS, 10% Glycerol

General Info

  • Alternative names

    • CD172 antigen like family member B
    • CD172b
    • CD172b antigen
    • DKFZp686A05192
    • Signal regulatory protein beta 1
    • SIRP BETA 1
    • SIRP beta 1 isoform 3
    see all
  • Relevance

    The protein encoded by the SIRPß1 gene is a member of the signal-regulatory-protein (SIRP) family, and also belongs to the immunoglobulin superfamily. SIRP family members are receptor-type transmembrane glycoproteins which are known to be involved in the negative regulation of receptor tyrosine kinase-coupled signaling processes. SIRPß1 was found to interact with TYROBP/DAP12, a protein bearing immunoreceptor tyrosine-based activation motifs. This protein was also reported to participate in the recruitment of tyrosine kinase SYK. Multiple transcript variants encoding different isoforms have been found for this gene.
  • Cellular localization

    Cell Membrane; single-pass type I membrane protein

Images

  • 15% SDS-PADE analysis of 3 µg ab235876.

References

ab235876 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235876.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up