Description

  • Product name

    Recombinant Human SIRT3 protein
    See all SIRT3 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab97951 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMSDKGKLSLQDVAELIRARACQRVVVMVGA GISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFF HNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERV SGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGV VKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRS SVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDL VQRETGKLDGPDK
    • Predicted molecular weight

      34 kDa including tags
    • Amino acids

      118 to 399
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab97951 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • hSIRT 3
    • hSIRT3
    • Mitochondrial nicotinamide adenine dinucleotide dependent deacetylase
    • NAD dependent deacetylase sirtuin 3 mitochondrial
    • NAD-dependent protein deacetylase sirtuin-3, mitochondrial
    • Regulatory protein SIR2 homolog 3
    • Silent mating type information regulation 2 S.cerevisiae homolog 3
    • Sir 2 like 3
    • SIR 2 like protein 3
    • SIR 3
    • SIR2 L3
    • Sir2 like 3
    • SIR2 like protein 3
    • SIR2-like protein 3
    • SIR2L3
    • SIR3_HUMAN
    • SIRT 3
    • SIRT3
    • Sirtuin 3
    • Sirtuin silent mating type information regulation 2 homolog 3 (S. cerevisiae)
    • Sirtuin type 3
    • Sirtuin3
    see all
  • Function

    NAD-dependent protein deacetylase. Activates or deactivates mitochondrial target proteins by deacetylating key lysine residues. Known targets include ACSS1, IDH, GDH, SOD2, PDHA1, LCAD, SDHA and the ATP synthase subunit ATP5O. Contributes to the regulation of the cellular energy metabolism. Important for regulating tissue-specific ATP levels.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Belongs to the sirtuin family. Class I subfamily.
    Contains 1 deacetylase sirtuin-type domain.
  • Post-translational
    modifications

    Processed by mitochondrial processing peptidase (MPP) to give a 28 kDa product. Such processing is probably essential for its enzymatic activity.
  • Cellular localization

    Mitochondrion matrix.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab97951 at approximately 33.5kDa (3µg).

References

This product has been referenced in:

  • Narayana YV  et al. Clathrin-Mediated Endocytosis Regulates a Balance between Opposing Signals to Maintain the Pluripotent State of Embryonic Stem Cells. Stem Cell Reports 12:152-164 (2019). Read more (PubMed: 30554918) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab97951.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up