Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMQWTRGRSRSHPGQGRSGESVEEVPLYGNL HYLQTGRLSQDPEPDQQDPTLGGPARAAEEVMCYTSLQLRPPQGRIPGPG TPVKYSEVVLDSEPKSQASGPEPELYASVCAQTRRARASFPDQAYANSQP AASLEHHHHHH
    • Amino acids

      65 to 196
    • Tags

      His tag C-Terminus , His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151377 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.

    pH: 8.00
    Constituents: 0.24% Tris, 0.06% EDTA, 1.45% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS.

General Info

  • Alternative names

    • gp30/40
    • SHP intracting transmembrane adapter protein
    • SHP2-interacting transmembrane adapter protein
    • Signaling threshold-regulating transmembrane adapter 1
    • SIT
    • Sit1
    • SIT1_HUMAN
    • Suppression inducing transmembrane adapter 1
    • Suppression-inducing transmembrane adapter 1
    see all
  • Function

    Negatively regulates TCR (T-cell antigen receptor)-mediated signaling in T-cells. Involved in positive selection of T-cells.
  • Tissue specificity

    Specifically expressed in T- and B-cells. Present in plasma cells but not in germinal center B-cells (at protein level). Expressed in T- and B-cell lymphoma.
  • Post-translational
    modifications

    Phosphorylated on tyrosines by LCK, FYN or ZAP70 upon TCR activation; which leads to the recruitment of PTPN11, GRB2 and CSK.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

References

ab151377 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151377.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up