Description

  • Product name

    Recombinant Human SKA2 protein (Tagged)
  • Purity

    > 90 % SDS-PAGE.
    ab199577 was refolded using a unique temperature shift inclusion body refolding technology and chromatographically purified.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHGNLYFQGGEFEAEVDKLELMFQKAESDLDYI QYRLEYEIKTNHPDSASEKNPVTLLKELSVIKSRYQTLYARFKPVAVEQK ESKSRICATVKKTMNMIQKLQKQTDLELSPLTKEEKTAAEQFKFHMPDL
    • Predicted molecular weight

      17 kDa including tags
    • Amino acids

      2 to 121
    • Additional sequence information

      Full lenght protein without starter Methionine, constructed with a small T7-His-TEV cleavage site Tag (29 amino acids) fusion at the N-terminal.

Specifications

Our Abpromise guarantee covers the use of ab199577 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituent: 0.32% Tris HCl

    Contains NaCl, KCl, EDTA, Sucrose, DTT.

General Info

  • Alternative names

    • FAM33A
    • Family with sequence similarity 33, member A
    • FLJ12758
    • MGC110975
    • Protein FAM33A
    • SKA 2
    • SKA2
    • SKA2_HUMAN
    • Spindle and kinetochore associated complex subunit 2
    • Spindle and kinetochore associated protein 2
    • Spindle and kinetochore-associated protein 2
    • Spindle and KT (kinetochore) associated 2
    • Spindle and KT associated 2
    see all
  • Function

    Component of the SKA1 complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation. Required for timely anaphase onset during mitosis, when chromosomes undergo bipolar attachment on spindle microtubules leading to silencing of the spindle checkpoint. The SKA1 complex is a direct component of the kinetochore-microtubule interface and directly associates with microtubules as oligomeric assemblies. The complex facilitates the processive movement of microspheres along a microtubule in a depolymerization-coupled manner. In the complex, it is required for SKA1 localization.
  • Sequence similarities

    Belongs to the SKA2 family.
  • Cellular localization

    Cytoplasm > cytoskeleton > spindle. Chromosome > centromere > kinetochore. Localizes to the outer kinetochore and spindle microtubules during mitosis in a NDC80 complex-dependent manner. Localizes to both the mitotic spindle and kinetochore-associated proteins.
  • Information by UniProt

References

ab199577 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab199577.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up