Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MQAAALPEEIRWLLEDAEEFLAEGLRNENLSAVARDHRDHILRGFQQIKA RYYWDFQPQGGDIGQDSSDDNHSGTLGLSLTSDAPFLSDYQDEGMEDIVK
    • Amino acids

      1 to 100
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160124 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • pp55
    • SCAP 1
    • SCAP1
    • SKAP 1
    • SKAP 55
    • SKAP-55
    • Skap1
    • SKAP1_HUMAN
    • SKAP55 adaptor protein
    • SRC family associated phosphoprotein 1
    • Src family-associated phosphoprotein 1
    • Src kinase associated phosphoprotein 1
    • SRC kinase associated phosphoprotein 55 kD
    • Src kinase associated phosphoprotein of 55 kDa
    • Src kinase-associated phosphoprotein 1
    • Src kinase-associated phosphoprotein of 55 kDa
    see all
  • Function

    Positively regulates T-cell receptor signaling by enhancing the MAP kinase pathway. Required for optimal conjugation between T-cells and antigen-presenting cells by promoting the clustering of integrin ITGAL on the surface of T-cells. May be involved in high affinity immunoglobulin epsilon receptor signaling in mast cells.
  • Tissue specificity

    Highly expressed in thymocytes and peripheral blood lymphocytes. Also expressed in spleen cells and testis. Present in T-cells (at protein level).
  • Sequence similarities

    Belongs to the SKAP family.
    Contains 1 PH domain.
    Contains 1 SH3 domain.
  • Domain

    The SH3 domain interacts with FYB.
  • Post-translational
    modifications

    Phosphorylated on tyrosines. Phosphorylation by FYN on Tyr-271 is required for GRB2 interaction. Phosphorylation by FYN on Tyr-295 abolishes interaction with FYB. Tyr-232 is dephosphorylated by PTPRC.
  • Cellular localization

    Cytoplasm. Nucleus. Cell membrane. Upon T-cell stimulation, translocates to lipid rafts at the cell membrane.
  • Information by UniProt

Images

  • ab160124 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160124 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160124.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up