Recombinant Human SLAM / CD150 protein (Tagged) (Biotin) (ab246194)

Description

  • Product name

    Recombinant Human SLAM / CD150 protein (Tagged) (Biotin)
    See all SLAM / CD150 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    The biotin to protein ratio is 0.5-1 as determined by the HABA assay.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSL ENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLM TLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGD HVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQ TFSPWPGCRTDPSETKP
    • Predicted molecular weight

      28 kDa including tags
    • Amino acids

      21 to 237
    • Tags

      His tag C-Terminus , Avi tag C-Terminus
    • Additional sequence information

      Extracellular domain. AviTag sequence GLNDIFEAQKIEWHE.
  • Conjugation

    Biotin

Specifications

Our Abpromise guarantee covers the use of ab246194 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    Biotinylation of this product is performed using Avitag™ technology. Briefly, the single lysine residue in the Avitag is enzymatically labeled with biotin.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle. Store In the Dark.

    pH: 7.4
    Constituents: PBS, 5% Trehalose

    0.22 µm filtered

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long-term storage.

General Info

  • Alternative names

    • 4933415F16
    • AA177906
    • CD 150
    • CD150
    • CD150 antigen
    • CDw150
    • Estm51
    • Ipo 3
    • IPO-3
    • Ipo3
    • MGC151472
    • MGC151476
    • OTTHUMP00000025670
    • OTTHUMP00000060252
    • RGD1560634
    • Signaling lymphocytic activation molecule
    • Signaling lymphocytic activation molecule family member 1
    • Signaling lymphocytic activation molecule family member 1, isoform CRA_a
    • Signaling lymphocytic activation molecule family member 1, isoform CRA_b
    • Signaling lymphocytic activation molecule precursor
    • Slaf1
    • SLAF1_HUMAN
    • SLAM family, member 1
    • Slamf 1
    • SLAMF1
    • SLAMF1 protein
    see all
  • Function

    High-affinity self-ligand important in bidirectional T-cell to B-cell stimulation. SLAM-induced signal-transduction events in T-lymphocytes are different from those in B-cells. Two modes of SLAM signaling are likely to exist: one in which the inhibitor SH2D1A acts as a negative regulator and another in which protein-tyrosine phosphatase 2C (PTPN11)-dependent signal transduction operates.
  • Tissue specificity

    Constitutively expressed on peripheral blood memory T-cells, T-cell clones, immature thymocytes and a proportion of B-cells, and is rapidly induced on naive T-cells after activation.
  • Sequence similarities

    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Domain

    The most membrane-proximal SH2-binding motif interacts with SH2 domain of SH2D1A and does not need to be phosphorylated on tyrosine residues.
  • Post-translational
    modifications

    Phosphorylated by FYN.
  • Cellular localization

    Cell membrane. Present on the surface of B-cells and T-cells.
  • Information by UniProt

Images

  • SDS-PAGE - Human SLAM / CD150 protein (Tagged) (ab246194).

    The gel was stained overnight with Coomassie Blue.

    The protein migrates as 42-60 kDa under reducing conditions due to glycosylation.

References

ab246194 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246194.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up