Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      ASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSL ENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLM TLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGD HVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQ TFSPWPGCRTDPSETKPVDHHHHHH
    • Molecular weight

      25 kDa including tags
    • Amino acids

      21 to 237
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151342 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 7.40
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. Dissolve the lyophilized protein in 1X PBS. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names

    • 4933415F16
    • AA177906
    • CD 150
    • CD150
    • CD150 antigen
    • CDw150
    • Estm51
    • Ipo 3
    • IPO-3
    • Ipo3
    • MGC151472
    • MGC151476
    • OTTHUMP00000025670
    • OTTHUMP00000060252
    • RGD1560634
    • Signaling lymphocytic activation molecule
    • Signaling lymphocytic activation molecule family member 1
    • Signaling lymphocytic activation molecule family member 1, isoform CRA_a
    • Signaling lymphocytic activation molecule family member 1, isoform CRA_b
    • Signaling lymphocytic activation molecule precursor
    • Slaf1
    • SLAF1_HUMAN
    • SLAM family, member 1
    • Slamf 1
    • SLAMF1
    • SLAMF1 protein
    see all
  • Function

    High-affinity self-ligand important in bidirectional T-cell to B-cell stimulation. SLAM-induced signal-transduction events in T-lymphocytes are different from those in B-cells. Two modes of SLAM signaling are likely to exist: one in which the inhibitor SH2D1A acts as a negative regulator and another in which protein-tyrosine phosphatase 2C (PTPN11)-dependent signal transduction operates.
  • Tissue specificity

    Constitutively expressed on peripheral blood memory T-cells, T-cell clones, immature thymocytes and a proportion of B-cells, and is rapidly induced on naive T-cells after activation.
  • Sequence similarities

    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Domain

    The most membrane-proximal SH2-binding motif interacts with SH2 domain of SH2D1A and does not need to be phosphorylated on tyrosine residues.
  • Post-translational
    modifications

    Phosphorylated by FYN.
  • Cellular localization

    Cell membrane. Present on the surface of B-cells and T-cells.
  • Information by UniProt

References

ab151342 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151342.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up