Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSQSSLTPLMVNGILGESVTLPLEFPAGE KVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSN LKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCE LHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAE NAVSNLSFSVSAQKLCEDVKIQYTDTKM
    • Molecular weight

      26 kDa including tags
    • Amino acids

      22 to 226
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab137148 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 85 % SDS-PAGE.
    purified by using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 2.4% Urea, 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • Activating NK receptor
    • CD352
    • KALI
    • KALIb
    • LY108
    • MGC104953
    • Natural killer T and B cell antigen
    • NK T B antigen
    • NK-, T-, and B-cell antigen
    • NK-T-B-antigen
    • NTB A
    • NTB-A
    • NTBA
    • NTBA receptor
    • SF2000
    • SLAF6_HUMAN
    • SLAM family member 6
    • SLAM family member 6 precursor
    • SLAM Family Receptor
    • Slamf6
    see all
  • Function

    Triggers cytolytic activity only in natural killer cells (NK) expressing high surface densities of natural cytotoxicity receptors.
  • Tissue specificity

    Expressed by all (resting and activated) natural killer cells (NK), T- and B-lymphocytes.
  • Sequence similarities

    Contains 1 Ig-like (immunoglobulin-like) domain.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab137148.

References

ab137148 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab137148.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up