Description

  • Product name

    Recombinant Human SLAMF6 protein (Tagged) (Biotin)
    See all SLAMF6 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    The biotin to protein ratio is 0.5-1 as determined by the HABA assay.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETK SPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSS YTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGN TLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQY TDTKM
    • Predicted molecular weight

      27 kDa including tags
    • Amino acids

      22 to 226
    • Tags

      His tag C-Terminus , Avi tag C-Terminus
    • Additional sequence information

      Extracellular domain. Biotinylated using Avitag™ technology. Briefly, the single lysine residue in the Avitag™ is enzymatically labeled with biotin. Avitag™ sequence GLNDIFEAQKIEWHE.
  • Conjugation

    Biotin

Specifications

Our Abpromise guarantee covers the use of ab246132 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle. Store In the Dark.

    pH: 7.40
    Constituents: PBS, 5% Trehalose

    0.22 µm filtered

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in 1000 ul sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • Activating NK receptor
    • CD352
    • KALI
    • KALIb
    • LY108
    • MGC104953
    • Natural killer T and B cell antigen
    • NK T B antigen
    • NK-, T-, and B-cell antigen
    • NK-T-B-antigen
    • NTB A
    • NTB-A
    • NTBA
    • NTBA receptor
    • SF2000
    • SLAF6_HUMAN
    • SLAM family member 6
    • SLAM family member 6 precursor
    • SLAM Family Receptor
    • Slamf6
    see all
  • Function

    Triggers cytolytic activity only in natural killer cells (NK) expressing high surface densities of natural cytotoxicity receptors.
  • Tissue specificity

    Expressed by all (resting and activated) natural killer cells (NK), T- and B-lymphocytes.
  • Sequence similarities

    Contains 1 Ig-like (immunoglobulin-like) domain.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab246132 under reducing conditions.

    The protein has a calculated MW of 26.8 kDa. The protein migrates as 35-44 kDa under reducing conditions due to glycosylation.

     

References

ab246132 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246132.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up