Recombinant Human SLAMF7/CS1 protein (ab151337)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Tags: His tag C-Terminus
- Suitable for: SDS-PAGE, HPLC
Description
-
Product name
Recombinant Human SLAMF7/CS1 protein
See all SLAMF7/CS1 proteins and peptides -
Purity
> 95 % SDS-PAGE.
The purity of ab151337 is greater than 95%, as determined by SEC-HPLC and reducing SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIV TQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVL HVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAAN ESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDP DSSVDHHHHHH -
Predicted molecular weight
23 kDa including tags -
Amino acids
23 to 225 -
Tags
His tag C-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab151337 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
HPLC
-
Form
Lyophilized -
Additional notes
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Aliquots of reconstituted samples are stable at <-20°C for 3 months.This product was previously labelled as SLAMF7
This product was previously labelled as SLAMF7
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C. Avoid freeze / thaw cycle. Please see notes section.
pH: 7.40
Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride -
ReconstitutionDissolve the lyophilized protein in 1X PBS.
It is not recommended to reconstitute to a concentration less than 100 µg/ml.
General Info
-
Alternative names
- 19A
- 19A24 protein
- CD 319
see all -
Relevance
SLAMF7 contains one Ig-like C2-type (immunoglobulin-like) domain. Isoform 1 mediates NK cell activation through a SAP-independent extracellular signal-regulated ERK-mediated pathway. It may play a role in lymphocyte adhesion. Isoform 3 does not mediate any activation. SAP can bind the cytoplasmic tail of isoform 1 when phosphorylated in the presence of Fyn (in vitro). SLAMF7 is expressed in spleen, lymph node, peripheral blood leukocytes, bone marrow, small intestine, stomach, appendix, lung and trachea. Expression was detected in NK cells, activated B-cells, NK-cell line but not in promyelocytic, B-, or T-cell lines. The isoform 3 is expressed at much lower level than isoform 1. There are three named isoforms. -
Cellular localization
Membrane; Single-pass type I membrane protein.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (1)
ab151337 has been referenced in 1 publication.
- Ishibashi M et al. Clinical impact of serum soluble SLAMF7 in multiple myeloma. Oncotarget 9:34784-34793 (2018). PubMed: 30410677