Description

  • Product name

    Recombinant Human SLAP2 protein (denatured)
    See all SLAP2 proteins and peptides
  • Purity

    > 80 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMGSLPSRRKSLPSPSLSSSVQGQGPVT MEAERSKATAVALGSFPAGGPAELSLRLGEPLTIVSEDGDWWTVLSEVSG REYNIPSVHVAKVSHGWLYEGLSREKAEELLLLPGNPGGAFLIRESQTRR GSYSLSVRLSRPASWDRIRHYRIHCLDNGWLYISPRLTFPSLQALVDHYS ELADDICCLLKEPCVLQRAGPLPGKDIPLPVTVQRTPLNWKELDSSLLFS EAATGEESLLSEGLRESLSFYISLNDEAVSLDDA
    • Predicted molecular weight

      31 kDa including tags
    • Amino acids

      1 to 261
    • Tags

      His tag N-Terminus
    • Additional sequence information

      (NCBI Accession No. NP_115590).
  • Description

    Recombinant Human SLAP2 protein

Specifications

Our Abpromise guarantee covers the use of ab174415 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

General Info

  • Alternative names

    • A930009E21Rik
    • AI430952
    • C20orf156
    • FLJ21992
    • MARS
    • MGC49845
    • Modulator of antigen receptor signaling
    • RGD1562071
    • SLA 2
    • SLA2
    • SLAP 2
    • SLAP-2
    • SLAP2
    • SLAP2_HUMAN
    • Src like adapter protein 2
    • Src like adaptor 2
    • Src-like adapter protein 2
    • Src-like-adapter 2
    see all
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab174415 (3 µg).

References

ab174415 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174415.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up