Description

  • Product name

    Recombinant Human SLC10A7 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MRLLERMRKDWFMVGIVLAIAGAKLEPSIGVNGGPLKPEITVSYIAVATI FFNSGLSLKTEELTSALVHLKLHLFIQIFTLAFFPATIWLFLQLLSITPI NEWLLKGLQTVGCMPPPVSSAVILTKAVGGNEAAAIFNSAFGSFLVSKHS LTCLLQLLL
    • Amino acids

      1 to 159
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164486 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 2410193C02Rik
    • C4orf13
    • DKFZp313H0531
    • DKFZp566M114
    • DKFZp779O2438
    • MGC25043
    • Na(+)/bile acid cotransporter 7
    • NTCP7_HUMAN
    • P7
    • PSEC0051
    • SBF domain containing protein
    • Slc10a7
    • Sodium/bile acid cotransporter 7
    • Solute carrier family 10 (sodium/bile acid cotransporter family), member 7
    • Solute carrier family 10 member 7
    see all
  • Sequence similarities

    Belongs to the sodium:bile acid symporter family.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab164486 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164486 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164486.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up