Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MSLNNSSNVFLDSVPSNTNRFQVSVINENHESSAAADDNTDPPHYEETSF GDEAQKRLRISFRPGNQECYDNFLQSGETAKTDASFHAYDSHTNTYYLQT FGHNTMDAVPKIEYYRNTGSISGPKVNRPSLLEIHEQLAKNVAVTPSSAD RVANGDGIPGDEQAENKEDDQAGVVKFGWVKGVLVRCMLNIWGVMLFIRL SWIVGEAGIGLGVLIILLSTMVTSITGLSTSAIATNGFVRGGGAYYLISR SLGPEFGGSIGLIFAFANAVAVAMYVVGFAETVVDLLKESDSMMVDPTND IRIIGSITVVILLGISVAGMEWEAKAQVILLVILLIAIANFFIGTVIPSN NEKKSRGFFNYQASIFAENFGPRFTKGEGFFSVFAIFFPAATGILAGANI SGDLEALRKQGASPLPQGAQSRRRRQTSLI
    • Molecular weight

      73 kDa including tags
    • Amino acids

      1 to 430

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132662 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.

     This product was previously labelled as SLC12A1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • BSC1
    • Bumetanide sensitive sodium 3
    • Bumetanide-sensitive sodium-(potassium)-chloride cotransporter 2
    • Kidney specific Na K Cl symporter
    • Kidney-specific Na-K-Cl symporter
    • MGC48843
    • Na K 2Cl cotransporter
    • NKCC2
    • potassiumchloride cotransporter 2
    • S12A1_HUMAN
    • Slc12a1
    • sodium potassium chloride cotransporter 2
    • solute carrier family 12 (sodium/potassium/chloride transporters)
    • Solute carrier family 12 member 1
    see all
  • Function

    Electrically silent transporter system. Mediates sodium and chloride reabsorption. Plays a vital role in the regulation of ionic balance and cell volume.
  • Tissue specificity

    Kidney specific.
  • Involvement in disease

    Defects in SLC12A1 are the cause of Bartter syndrome type 1 (BS1) [MIM:601678]. BS refers to a group of autosomal recessive disorders characterized by impaired salt reabsorption in the thick ascending loop of Henle with pronounced salt wasting, hypokalemic metabolic alkalosis, and varying degrees of hypercalciuria. BS1 is a life-threatening condition beginning in utero, with marked fetal polyuria that leads to polyhydramnios and premature delivery. Another hallmark of BS1 is a marked hypercalciuria and, as a secondary consequence, the development of nephrocalcinosis and osteopenia.
  • Sequence similarities

    Belongs to the SLC12A transporter family.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132662 stained with Coomassie Blue

References

ab132662 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132662.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up