Overview

  • Product name

    Recombinant Human SLC12A6/KCC3 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MPHFTVTKVEDPEEGAAASISQEPSLADIKARIQDSDEPDLSQNSITGEH SQLLDDGHKKARNAYLNNSNYEEGDEYFDKNLALFEEEMD
    • Amino acids

      1 to 90
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160749 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as SLC12A6

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ACCPN
    • Electroneutral potassium-chloride cotransporter 3
    • Furosemide sensitive KCl cotransporter 3
    • Gaxp
    • K-Cl cotransporter 3
    • KCC 3
    • KCC 3A
    • KCC 3B
    • KCC3
    • KCC3 A
    • KCC3 B
    • KCC3A
    • KCC3B
    • Potassium chloride cotransporter 3
    • Potassium chloride cotransporter KCC3a S3
    • S12A6_HUMAN
    • SLC12 A6
    • SLC12A 6
    • SLC12A6
    • Solute carrier family 12 (potassium/chloride transporters), member 6
    • Solute carrier family 12 member 6
    • Solute carrier family 12, member 6
    see all
  • Function

    Mediates electroneutral potassium-chloride cotransport. May be activated by cell swelling. May contribute to cell volume homeostasis in single cells.
  • Tissue specificity

    Highly expressed in heart, brain and kidney. Detected at lower levels in skeletal muscle, placenta, lung and pancreas. Detected in umbilical vein endothelial cells. Isoform 2 is more abundant in kidney. Isoform 5 is testis specific. Expressed in the proximal tubule of the kidney (at protein level).
  • Involvement in disease

    Agenesis of the corpus callosum, with peripheral neuropathy
  • Sequence similarities

    Belongs to the SLC12A transporter family.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Basolateral cell membrane.
  • Information by UniProt

Images

  • ab160749 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160749 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160749.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up