Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VEAILQQMEATSAATEAGLELVDKGKAKELPGSQVIFEGPTLGQQEDQER KRLCK
    • Amino acids
      152 to 206
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166162 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Na(+)/citrate cotransporter
    • NaC2/NaCT
    • NaCT
    • Novel solute carrier family 13 (sodium dependent dicarboxylate transporter) (Slc13a2 or 3) member
    • S13A5_HUMAN
    • Slc13a5
    • Sodium coupled citrate transporter
    • Sodium-coupled citrate transporter
    • Sodium-dependent citrate transporter
    • Solute carrier family 13 (sodium dependent citrate transporter), member 5
    • Solute carrier family 13 member 5
    see all
  • Function
    High-affinity sodium/citrate cotransporter that mediates citrate entry into cells. The transport process is electrogenic; it is the trivalent form of citrate rather than the divalent form that is recognized as a substrate. May facilitate the utilization of circulating citrate for the generation of metabolic energy and for the synthesis of fatty acids and cholesterol.
  • Tissue specificity
    Expressed most predominantly in the liver, with moderate expression detectable in the brain and testis.
  • Sequence similarities
    Belongs to the SLC13A transporter (TC 2.A.47) family. NADC subfamily.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab166162 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166162 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166162.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up