Recombinant Human SLC15A3 protein (ab162498)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KPPMGSQVSSMLKLALQNCCPQLWQRHSARDRQCARVLADERSPQPGASP QEDIANFQ
    • Amino acids
      254 to 311
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162498 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ26631
    • OCTP
    • Osteoclast transporter
    • Peptide transporter 3
    • Peptide/histidine transporter 2
    • PHT2
    • PTR3
    • S15A3_HUMAN
    • SLC15A3
    • Solute carrier family 15 (oligopeptide transporter) member 3
    • Solute carrier family 15 member 3
    see all
  • Function
    Proton oligopeptide cotransporter. Transports free histidine and certain di- and tripeptides.
  • Sequence similarities
    Belongs to the PTR2/POT transporter (TC 2.A.17) family.
  • Cellular localization
    Lysosome membrane.
  • Information by UniProt

Images

  • ab162498 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162498 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162498.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up