Overview

  • Product name
    Recombinant Human SLC1A7 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MVPHAILARGRDVCRRNGLLILSVLSVIVGCLLGFFLRTRRLSPQEISYF QFPGELLMRMLKMMILPLVVSSLMSGLASLDAKTSSRLGVLTVAYYLWTT FMAVIVGIFMVSIIHPGSAAQKETTEQSGKPIMSSADALLDLIRQKEESW RNGPKGPG
    • Amino acids
      1 to 158
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159518 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AAAT
    • EAA5_HUMAN
    • EAAT5
    • Excitatory amino acid transporter 5
    • Excitatory amino acid transporter 5 (retinal glutamate transporter)
    • FLJ36602
    • Retinal glutamate transporter
    • Slc1a7
    • Solute carrier family 1 (glutamate transporter) member 7
    • Solute carrier family 1 member 7
    see all
  • Function
    Transports L-glutamate; the L-glutamate uptake is sodium- and voltage-dependent and chloride-independent. Its associated chloride conductance may participate in visual processing.
  • Tissue specificity
    Expressed primarily in retina. Detectable in liver, heart, muscle and brain.
  • Sequence similarities
    Belongs to the dicarboxylate/amino acid:cation symporter (DAACS) (TC 2.A.23) family. SLC1A7 subfamily.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab159518 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159518 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159518.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up