Overview

  • Product name

    Recombinant Human SLC20A1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MATLITSTTAATAASGPLVDYLWMLILGFIIAFVLAFSVGANDVANSFGT AVGSGVVTLKQACILASIFETVGSVLLGAKVSETIRKGLIDVEMYNSTQG LLMAGSVSAMFGSAVWQLVASFLKLPISGTHCIVGATIGFSLVAKGQEGV KWSELIKIVMSWFVSPLLSGIMSGILFFLVRAFILHKADPVPNGLRALPV FYACTVGINLFSIMYTGAPLLGFDKLPLWGTILISVGCAVFCALIVWFFV CPRMKRKIEREIKCSPSESPLMEKKNSLKEDHEETKLSVGDIENKHPVSE VGPATVPLQAVVEERTVSFKLGDLEEAPERERLPSVDLKEETSIDSTVNG AVQLPNGNLVQFSQAVSNQINSSGHYQYHTVHKDSGLYKELLHKLHLAKV GDCMGDSGDKPLRRNNSYTSYTMAICGMPLDSFRAKEGEQKGEEMEKLTW PNADSKKRIRMDSYTSYCNAVSDLHSASEIDMSVKAEMGLGDRKGSNGSL EEWYDQDKPEVSLLFQFLQILTACFGSFAHGGNDVSNAIGPLVALYLVYD TGDVSSKVATPIWLLLYGGVGICVGLWVWGRRVIQTMGKDLTPITPSSGF SIELASALTVVIASNIGLPISTTHCKVGSVVSVGWLRSKKAVDWRLFRNI FMAWFVTVPISGVISAAIMAIFRYVILRM
    • Molecular weight

      100 kDa including tags
    • Amino acids

      1 to 679

Specifications

Our Abpromise guarantee covers the use of ab132646 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DKFZp686J2397
    • FLJ41426
    • Gibbon ape leukemia virus receptor 1
    • GLVR 1
    • GLVR-1
    • GLVR1
    • Leukemia virus receptor 1 homolog
    • Phosphate transporter 1
    • PIT 1
    • PiT-1
    • PIT1
    • S20A1_HUMAN
    • Slc20a1
    • Sodium dependent phosphate transporter 1
    • Sodium-dependent phosphate transporter 1
    • Solute carrier family 20 (phosphate transporter) member 1
    • Solute carrier family 20 member 1
    see all
  • Function

    Sodium-phosphate symporter which plays a fundamental housekeeping role in phosphate transport, such as absorbing phosphate from interstitial fluid for normal cellular functions such as cellular metabolism, signal transduction, and nucleic acid and lipid synthesis. May play a role in extracellular matrix and cartilage calcification as well as in vascular calcification. May function as a retroviral receptor as it confers human cells susceptibility to infection to Gibbon Ape Leukemia Virus (GaLV), Simian sarcoma-associated virus (SSAV) and Feline leukemia virus subgroup B (FeLV-B) as well as 10A1 murine leukemia virus (10A1 MLV).
  • Tissue specificity

    Ubiquitously expressed.
  • Sequence similarities

    Belongs to the inorganic phosphate transporter (PiT) (TC 2.A.20) family.
  • Domain

    Region A confers human cells susceptibility to infection by Gibbon Ape Leukemia Virus (GaLV) and Feline leukemia virus subgroup B (FeLV-B). Substitution of Human SLC20A1 region A by region A of murine SLC20A1 prevents viral infection.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132646 stained with Coomassie Blue.

References

ab132646 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132646.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up