Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAMDEYLWMVILGFIIAFILAFSVGANDVANSFGTAVGSGVVTLRQACIL ASIFETTGSVLLGAKVGETIRKGIIDVNLYNETVETLMAGEVSAMVGSAV WQLIASFLRLPISGTHCIVGSTIGFSLVAIGTKGVQWMELVKIVASWFIS PLLSGFMSGLLFVLIRIFILKKEDPVPNGLRALPVFYAATIAINVFSIMY TGAPVLGLVLPMWAIALISFGVALLFAFFVWLFVCPWMRRKITGKLQKEG ALSRVSDESLSKVQEAESPVFKELPGAKANDDSTIPLTGAAGETLGTSEG TSAGSHPRAAYGRALSMTHGSVKSPISNGTFGFDGHTRSDGHVYHTVHKD SGLYKDLLHKIHIDRGPEEKPAQESNYRLLRRNNSYTCYTAAICGLPVHA TFRAADSSAPEDSEKLVGDTVSYSKKRLRYDSYSSYCNAVAEAEIEAEEG GVEMKLASELADPDQPREDPAEEEKEEKDAPEVHLLFHFLQVLTACFGSF AHGGNDVSNAIGPLVALWLIYKQGGVTQEAATPVWLLFYGGVGICTGLWV WGRRVIQTMGKDLTPITPSSGFTIELASAFTVVIASNIGLPVSTTHCKVG SVVAVGWIRSRKAVDWRLFRNIFVAWFVTVPVAGLFSAAVMALLMYGILP YV
    • Amino acids
      1 to 652
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159535 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Gibbon ape leukemia virus receptor 2
    • Gibbon leukemia virus receptor 2
    • GLVR 2
    • GLVR-2
    • GLVR2
    • hPit2
    • IBGC3
    • MLVAR
    • Murine leukemia virus amphotropic receptor
    • murine leukemia virus, amphotropic, receptor for
    • Phosphate transporter 2
    • PIT 2
    • PiT-2
    • Pit2
    • RAM1
    • S20A2_HUMAN
    • SLC20A2
    • Sodium-dependent phosphate transporter 2
    • Solute carrier family 20 (phosphate transporter) member 2
    • solute carrier family 20 (phosphate transporter), member 2
    • Solute carrier family 20 member 2
    see all
  • Function
    Sodium-phosphate symporter which seems to play a fundamental housekeeping role in phosphate transport by absorbing phosphate from interstitial fluid for normal cellular functions such as cellular metabolism, signal transduction, and nucleic acid and lipid synthesis. In vitro, sodium-dependent phosphate uptake is not siginificantly affected by acidic and alkaline conditions, however sodium-independent phosphate uptake occurs at acidic conditions. May play a role in extracellular matrix, cartilage and vascular calcification. Functions as a retroviral receptor and confers human cells susceptibility to infection to amphotropic murine leukemia virus (A-MuLV), 10A1 murine leukemia virus (10A1 MLV) and some feline leukemia virus subgroup B (FeLV-B) variants.
  • Tissue specificity
    Ubiquitously expressed.
  • Sequence similarities
    Belongs to the inorganic phosphate transporter (PiT) (TC 2.A.20) family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab159535 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159535 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159535.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up