Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MAMDEYLWMVILGFIIAFILAFSVGANDVANSFGTAVGSGVVTLRQACIL ASIFETTGSVLLGAKVGETIRKGIIDVNLYNETVETLMAGEVSAMVGSAV WQLIASFLRLPISGTHCIVGSTIGFSLVAIGTKGVQWMELVKIVASWFIS PLLSGFMSGLLFVLIRIFILKKEDPVPNGLRALPVFYAATIAINVFSIMY TGAPVLGLVLPMWAIALISFGVALLFAFFVWLFVCPWMRRKITGKLQKEG ALSRVSDESLSKVQEAESPVFKELPGAKANDDSTIPLTGAAGETLGTSEG TSAGSHPRAAYGRALSMTHGSVKSPISNGTFGFDGHTRSDGHVYHTVHKD SGLYKDLLHKIHIDRGPEEKPAQESNYRLLRRNNSYTCYTAAICGLPVHA TFRAADSSAPEDSEKLVGDTVSYSKKRLRYDSYSSYCNAVAEAEIEAEEG GVEMKLASELADPDQPREDPAEEEKEEKDAPEVHLLFHFLQVLTACFGSF AHGGNDVSNAIGPLVALWLIYKQGGVTQEAATPVWLLFYGGVGICTGLWV WGRRVIQTMGKDLTPITPSSGFTIELASAFTVVIASNIGLPVSTTHCKVG SVVAVGWIRSRKAVDWRLFRNIFVAWFVTVPVAGLFSAAVMALLMYGILP YV
    • Amino acids

      1 to 652
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159535 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as SLC20A2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Gibbon ape leukemia virus receptor 2
    • Gibbon leukemia virus receptor 2
    • GLVR 2
    • GLVR-2
    • GLVR2
    • hPit2
    • IBGC3
    • MLVAR
    • Murine leukemia virus amphotropic receptor
    • murine leukemia virus, amphotropic, receptor for
    • Phosphate transporter 2
    • PIT 2
    • PiT-2
    • Pit2
    • RAM1
    • S20A2_HUMAN
    • SLC20A2
    • Sodium-dependent phosphate transporter 2
    • Solute carrier family 20 (phosphate transporter) member 2
    • solute carrier family 20 (phosphate transporter), member 2
    • Solute carrier family 20 member 2
    see all
  • Function

    Sodium-phosphate symporter which seems to play a fundamental housekeeping role in phosphate transport by absorbing phosphate from interstitial fluid for normal cellular functions such as cellular metabolism, signal transduction, and nucleic acid and lipid synthesis. In vitro, sodium-dependent phosphate uptake is not siginificantly affected by acidic and alkaline conditions, however sodium-independent phosphate uptake occurs at acidic conditions. May play a role in extracellular matrix, cartilage and vascular calcification. Functions as a retroviral receptor and confers human cells susceptibility to infection to amphotropic murine leukemia virus (A-MuLV), 10A1 murine leukemia virus (10A1 MLV) and some feline leukemia virus subgroup B (FeLV-B) variants.
  • Tissue specificity

    Ubiquitously expressed.
  • Sequence similarities

    Belongs to the inorganic phosphate transporter (PiT) (TC 2.A.20) family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • ab159535 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159535 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159535.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up