Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAFSKLLEQAGGVGLFQTLQVLTFILPCLMIPSQMLLENFSAAIPGHRCW THMLDNGSAVSTNMTPKALLTISIPPGPNQGPHQCRRFRQPQWQLLDPNA TATSWSEADTEPCVDGWVYDRSVFTSTIVAKWDLVCSSQGLKPLSQSIFM SGILVGSFIWGLLSYRFGRKPMLSWCCLQLAVAGTSTIFAPTFVIYCGLR FVAAFGMAGIFLSSLTLMVEWTTTSRRAVTMTVVGCAFSAGQAALGGLAF ALRDWRTLQLAASVPFFAISLISWWLPESARWLIIKGKPDQALQELRKVA RINGHKEAKNLTIEVLMSSVKEEVASAKEPRSVLDLFCVPVLRWRSCAML VVNFSLLISYYGLVFDLQSLGRDIFLLQALFGAVDFLGRATTALLLSFLG RRTIQAGSQAMAGLAILANMLVPQDLQTLRVVFAVLGKGCFGISLTCLTI YKAELFPTPVRMTADGILHTVGRLGAMMGPLILMSRQALPLLPPLLYGVI SIASSLVVLFFLPETQGLPLPDTIQDLESQKSTAAQGNRQEAVTVESTSL
    • Amino acids
      1 to 550
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163259 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • hOAT4
    • MGC34282
    • OAT4
    • Organic anion transporter 4
    • Solute carrier family 22 (organic anion/urate transporter) member 11
    • Solute carrier family 22 member 11
    see all
  • Relevance
    SLC22A11 is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. It is an integral membrane protein and is found mainly in the kidney and in the placenta, where it may act to prevent potentially harmful organic anions from reaching the fetus. SLC22A11 mediates saturable uptake of estrone sulfate, dehydroepiandrosterone sulfate and related compounds.
  • Cellular localization
    Cell membrane; Multi-pass membrane protein.

Images

  • ab163259 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163259 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163259.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up