Overview

  • Product name

    Recombinant Human SLC22A13 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      AHVFMVLDEPHHCAVAWVKNHTFNLSAAEQLVLSVPLDTAGHPEPCLMFR PPPANASLQDILSHRFNETQPCDMGWEYPENRLPSLKNEFNLVCDRKHLK DT
    • Amino acids

      38 to 139
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160466 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • OAT10
    • OCTL 1
    • OCTL 3
    • OCTL1
    • OCTL3
    • ORCTL 3
    • ORCTL3
    • Organic cation transporter like 3
    • Organic cationic transporter like 3
    • Solute carrier family 22 (organic cation transporter) member 13
    • Solute carrier family 22 member 13
    see all
  • Relevance

    This gene encodes a member of the organic cation transporter family. It is located in a gene cluster with another member of the family, organic cation transporter like 4. The encoded protein is a transmembrane protein involved in the transport of small molecules. This protein can function to mediate urate uptake and is a high affinity nicotinate exchanger in the kidneys and the intestine.
  • Cellular localization

    Membrane; Multi pass membrane protein.

Images

  • ab160466 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160466 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160466.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up